DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and CG30486

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster


Alignment Length:254 Identity:81/254 - (31%)
Similarity:124/254 - (48%) Gaps:12/254 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIILGMASSQPLS--WCDPDLCPDNTVHIACNNDGKFHESCSPDATM----VDLKPYRKLIVNEH 71
            ::|:.:.|.:.||  :|:.|||.....||||.|.|.|.|||..:|.:    :.::.:...::|:.
  Fly     7 VLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDF 71

  Fly    72 NKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVD 136
               ||.:|.|..|...||:||||:.|.|||..||...|:.|....|.|.|:..|..:.. :.|..
  Fly    72 ---RNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSY-IYGST 132

  Fly   137 RRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRF 201
            :....:.:..::::..:..|..:.|....::|...|..||.:..|:|.:.|.|...||||||| .
  Fly   133 KWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMM-L 196

  Fly   202 TNPQYPFLYIYNTACNYASVYAIGVPVYNA-GKPASECRTGSNPEYPALCSIKEQYNPN 259
            ...|...||.|...|:::........||.| ..|.|.|..|::..|..|||.:|..|||
  Fly   197 RKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEHVNPN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 47/154 (31%)
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 47/157 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440603
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.