DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and PI16

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001186088.1 Gene:PI16 / 221476 HGNCID:21245 Length:463 Species:Homo sapiens


Alignment Length:225 Identity:54/225 - (24%)
Similarity:77/225 - (34%) Gaps:68/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HESCS-----------------PDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATM 95
            |.|||                 |...:.|.:  ::|:|..||..|..::.       .|:.|..|
Human     2 HGSCSFLMLLLPLLLLLVATTGPVGALTDEE--KRLMVELHNLYRAQVSP-------TASDMLHM 57

  Fly    96 VWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLC-----GVDRRRNWDLNVTNLVEQSMGL 155
            .|||||...|....:.|...    ||..|.|. |:||.     |:|            |..:|..
Human    58 RWDEELAAFAKAYARQCVWG----HNKERGRR-GENLFAITDEGMD------------VPLAMEE 105

  Fly   156 WFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAM--------MRFTNPQYPFLYIY 212
            |..|.:..:.|..|    ....:..||:.:.|..:...:||..        :..||       |.
Human   106 WHHEREHYNLSAAT----CSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETN-------IE 159

  Fly   213 NTACNYASVYAI-GVPVYNAGKPASECRTG 241
            ...|||.....: |...|..|.|.|:|.:|
Human   160 LLVCNYEPPGNVKGKRPYQEGTPCSQCPSG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 40/167 (24%)
PI16NP_001186088.1 SCP_HrTT-1 33..166 CDD:240186 40/167 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..408
O-glycosylated at one site 386..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.