DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and F58E2.5

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_500349.1 Gene:F58E2.5 / 186521 WormBaseID:WBGene00019049 Length:232 Species:Caenorhabditis elegans


Alignment Length:248 Identity:55/248 - (22%)
Similarity:76/248 - (30%) Gaps:117/248 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KLIVNEHNKRRNYIASG-----------SLPGYYPATRMATMVWDEELEYLATLNLKTC------ 112
            |.|:|.:|..|:.||:|           ::| ..||..|..:.|:..|..||...:.:|      
 Worm    41 KDILNAYNNLRSEIANGTFTMKLQFPDITIP-LAPAAGMLKLKWNCRLAALAQAYVDSCPSYQDL 104

  Fly   113 ------------YL-----EHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEH 160
                        :|     ||......|||:     :..:|.||.: :|..         ||  .
 Worm   105 RVHKPKFPVTYSFLDANLQEHIKDPVLYRFK-----ILEMDFRRGY-INDD---------WF--K 152

  Fly   161 KLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTACNY-ASVY-- 222
            |||.|.                          .:|||   |.|.....|::    |.| ..:|  
 Worm   153 KLISSK--------------------------SIGCA---FNNCSENVLFV----CYYKEQIYED 184

  Fly   223 ----AIG--------------VPVYNAGK------PASECRTGSNPEYPALCS 251
                ..|              ||.|..||      |.:.||..|     .|||
 Worm   185 FKFPVNGGAEPGRFIKELDDYVPRYKEGKACSACPPPTSCRGSS-----VLCS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 41/188 (22%)
F58E2.5NP_500349.1 CAP_euk 40..177 CDD:349399 40/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.