Sequence 1: | NP_611581.1 | Gene: | CG9822 / 37440 | FlyBaseID: | FBgn0034623 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500349.1 | Gene: | F58E2.5 / 186521 | WormBaseID: | WBGene00019049 | Length: | 232 | Species: | Caenorhabditis elegans |
Alignment Length: | 248 | Identity: | 55/248 - (22%) |
---|---|---|---|
Similarity: | 76/248 - (30%) | Gaps: | 117/248 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 KLIVNEHNKRRNYIASG-----------SLPGYYPATRMATMVWDEELEYLATLNLKTC------ 112
Fly 113 ------------YL-----EHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEH 160
Fly 161 KLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTACNY-ASVY-- 222
Fly 223 ----AIG--------------VPVYNAGK------PASECRTGSNPEYPALCS 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9822 | NP_611581.1 | SCP_euk | 64..219 | CDD:240180 | 41/188 (22%) |
F58E2.5 | NP_500349.1 | CAP_euk | 40..177 | CDD:349399 | 40/186 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |