DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and scl-9

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_502497.1 Gene:scl-9 / 186048 WormBaseID:WBGene00009890 Length:213 Species:Caenorhabditis elegans


Alignment Length:205 Identity:47/205 - (22%)
Similarity:79/205 - (38%) Gaps:53/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIASGSL-------PGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYR 124
            ::|.||:.|:.:|.|.|       |.   |:.|..:.|.::|...||...:||...|....|:  
 Worm    28 LLNVHNEFRSQLALGQLSFRGVKKPS---ASMMRKISWSKKLTNAATKFAETCPKNHSVVMNT-- 87

  Fly   125 FRNLGQNLCGVDRRRNWDLNVT-NLVEQSMGL----WFGEHK------LIDSSYITDFKLTKDLE 178
                |:::.       |..:.: :..||...|    |:.|.:      ||.:.....|::     
 Worm    88 ----GESIF-------WHFSSSLSTPEQYATLAPQKWWNEFETNGWDSLIYNHASQRFQI----- 136

  Fly   179 KYGHFVETVLDRNTHVGCAMMRFT--NPQYPFLYIYNTACNYASVYAI-GVPVYNAGKPASECRT 240
              ||.|:......:.|||...:..  .|:...:.:    |.|.....| |.|:||.|:..::|  
 Worm   137 --GHAVQMAWHTTSKVGCGYSKCAVGTPEQTMVVV----CRYFQKGNIEGEPIYNEGETCTKC-- 193

  Fly   241 GSNPEYPALC 250
               ||....|
 Worm   194 ---PEEYQKC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 36/171 (21%)
scl-9NP_502497.1 SCP 23..174 CDD:214553 37/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.