DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and scl-24

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_507429.1 Gene:scl-24 / 184188 WormBaseID:WBGene00008575 Length:212 Species:Caenorhabditis elegans


Alignment Length:194 Identity:42/194 - (21%)
Similarity:78/194 - (40%) Gaps:45/194 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIASGSLPGY--YPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLG 129
            ||..|||.||..:.|....|  ..::.|..:.|:|.|  :|.:..:..|.|..|  |......||
 Worm    34 IVFIHNKLRNAASHGLWERYSISKSSNMQLLSWNESL--VAEVENEKYYCEPAD--NKNLPIKLG 94

  Fly   130 QNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHV 194
            .|:      ..:|:|..:.:: .:|.....:|...::..::.|.||:     ...:.:..::..:
 Worm    95 DNI------YQYDVNTYDDID-GVGAMGSINKDTHNALKSEEKATKN-----RLRQMLYSKSKSI 147

  Fly   195 GCAMMRFTNPQYPFLY-----------IYNT---ACNYA-SVYAIGVPVYNAGKPASECRTGSN 243
            ||            :|           .|||   .|.|: .:..|...:::.|:|.|.|.:|::
 Worm   148 GC------------IYESCDKIDSKGINYNTRLVICKYSPPLENIDEQLFDKGEPCSNCPSGTS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 35/167 (21%)
scl-24NP_507429.1 CAP_euk 31..174 CDD:349399 35/167 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.