DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and scl-26

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_504963.1 Gene:scl-26 / 183662 WormBaseID:WBGene00016821 Length:208 Species:Caenorhabditis elegans


Alignment Length:206 Identity:46/206 - (22%)
Similarity:76/206 - (36%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIASG--SLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHD--DCHN-SYRFR 126
            :|..|||.||..:.|  :......:|.|..:.|:..|         ....:|:  ||.. ..|..
 Worm    30 LVFVHNKLRNDASQGLWARHNISKSTDMQKLFWNNSL---------VAEAKHEMYDCDQLEKREL 85

  Fly   127 NLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRN 191
            .||:|:      ..:|:...:.|:...    ||..:...|:  |...:||........:.:..::
 Worm    86 TLGENI------YQYDVTTYDDVDGQQ----GEAAINKDSH--DALSSKDQAAQYRLRQILYSKS 138

  Fly   192 THVGCAMM-------RFTNPQYPFLYIYNT---ACNYA-SVYAIGVPVYNAGKPA-SECRTGSNP 244
            ..:||...       ..||        |||   .|.|: ::..|...:|..|:.| |.|.:|::.
 Worm   139 NSIGCIYESCDRIDDEGTN--------YNTRFIICKYSPALKNIDDQLYEEGEEACSNCPSGTSC 195

  Fly   245 EYP--ALCSIK 253
            ..|  .||..|
 Worm   196 TDPMMKLCEKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 34/166 (20%)
scl-26NP_504963.1 CAP_euk 30..168 CDD:349399 34/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.