DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and vap-1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:254 Identity:59/254 - (23%)
Similarity:95/254 - (37%) Gaps:64/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ACNNDGK---FHES------C--SPDATMVDL-----------KPYRKLIVNEHNKRRNYIASGS 82
            ||.:|.:   :.:|      |  :|.|.:|:.           ...|:..::.|||.|..:|.|.
 Worm   190 ACTSDAECTTYSDSQCKNGLCYKAPQAPVVETFTMCPSVTDQSDQARQNFLDTHNKLRTSLAKGL 254

  Fly    83 LPGYYPATRMATMVWD-EELEYLATL--NLKT----CYLEHDDCHNSYRFRNLGQNLCGVDRRRN 140
            ......|...|.|... .:|:|..|:  |.:|    |..:|.   .|.:...||:||        
 Worm   255 EADGIAAGAFAPMAKQMPKLKYSCTVEANARTWAKGCLYQHS---TSAQRPGLGENL-------- 308

  Fly   141 WDLNVTNL-----VEQSMGLWFGEHKLIDSSYITDFKLTKDL--EKYGHFVETVLDRNTHVGCAM 198
            :.:::.|:     .|.|...|:.|.|  |....:|..||:.:  ...||:.:...:..|.:||  
 Worm   309 YMISINNMPKIQTAEDSSKAWWSELK--DFGVGSDNILTQAVFDRGVGHYTQMAWEGTTEIGC-- 369

  Fly   199 MRFTNPQYPFLYI---YNTACNYASVYAIGVPVYNAGKPASECRTGSNPEYPALCSIKE 254
              |......|.|.   |..|.||.:..     :|..|.|   |...::......||:.|
 Worm   370 --FVENCPTFTYSVCQYGPAGNYMNQL-----IYTKGSP---CTADADCPGTQTCSVAE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 43/171 (25%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553
SCP 234..386 CDD:214553 41/168 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.