DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and lon-1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:217 Identity:54/217 - (24%)
Similarity:83/217 - (38%) Gaps:60/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFR-N 127
            :|.|.:|||:.|..:         ||:.|..:.|.:||...|..:..||...|.      |.| |
 Worm    81 KKWITHEHNRYRRMV---------PASDMNMLYWSDELAASAQRHADTCDFRHS------RGRIN 130

  Fly   128 LGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGE-HKL---IDSSYITDFKLTKDLEKY--GHFVET 186
            :|:|:        |....:| ...::.:||.| |..   .:.:|           |:  ||:|:.
 Worm   131 VGENI--------WAAPYSN-YSDAISIWFNEVHNPRCGCNHAY-----------KHCCGHYVQV 175

  Fly   187 VLDRNTHVGCAMMRFTNPQ--------YPFLYIYNTACNYASVYAIG----VPVY-----NAGKP 234
            |..:...|||...|..:.|        ..|:..||...|...|.|.|    :|.:     :.|| 
 Worm   176 VWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGNTVFVTARGQLYAMPAFTWASGDNGK- 239

  Fly   235 ASECRTGSNPEYPALCSIKEQY 256
            .|.|...:...|..||.:.:.|
 Worm   240 CSNCPANAPACYQGLCYMPKNY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 42/169 (25%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 40/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.