DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and CRISP1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:228 Identity:51/228 - (22%)
Similarity:78/228 - (34%) Gaps:77/228 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHN 121
            :.||...::.|||.||..|..:..       ||:.|..|.|.||....|.:..|.|    |...:
Human    34 VTDLPNVQEEIVNIHNALRRRVVP-------PASNMLKMSWSEEAAQNARIFSKYC----DMTES 87

  Fly   122 SYRFRNLGQNLCGVDRRR-----NWDLNVTNLVEQSMGLWFGEHKLIDSSY------ITDFKLTK 175
            :...|.|....||.:...     :|        ...:|:|:.|    .:|:      .||..:|.
Human    88 NPLERRLPNTFCGENMHMTSYPVSW--------SSVIGVWYSE----STSFKHGEWTTTDDDITT 140

  Fly   176 DLEKYGHFVETVLDRNTHVGCAMMRFTNPQYP-FLYIYNTACNYASVYAIGVPVYNAGKPASECR 239
            |     |:.:.|...:..:|||:........| :||:    |:|                   |.
Human   141 D-----HYTQIVWATSYLIGCAIASCRQQGSPRYLYV----CHY-------------------CH 177

  Fly   240 TGSNPE--------------YPALCSIKEQYNP 258
            .|::||              .|:.|..|...||
Human   178 EGNDPETKNEPYKTGVPCEACPSNCEDKLCTNP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 39/166 (23%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 40/188 (21%)
Crisp 195..249 CDD:285731 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151257
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.