DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and GLIPR1L2

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001257325.1 Gene:GLIPR1L2 / 144321 HGNCID:28592 Length:344 Species:Homo sapiens


Alignment Length:216 Identity:54/216 - (25%)
Similarity:79/216 - (36%) Gaps:54/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PDATMVD-LKPYRKLIVNEHNK-RRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLE 115
            ||...|| :..|    ||.||: |.:.|..||        .:..|.||..|...|....|.|.. 
Human    46 PDEEDVDFINEY----VNLHNELRGDVIPRGS--------NLRFMTWDVALSRTARAWGKKCLF- 97

  Fly   116 HDDCHNSY---------RFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGL--WFGEHKLIDSSYIT 169
               .||.|         :|..:|:|:        | :...|....|:.:  |..|.|:.:   ..
Human    98 ---THNIYLQDVQMVHPKFYGIGENM--------W-VGPENEFTASIAIRSWHAEKKMYN---FE 147

  Fly   170 DFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTA---CNYASVYAIGVPVYNA 231
            :...:.|...|   ::.|.|.:..||||:    .|.....:|.:.|   ||||....:....|..
Human   148 NGSCSGDCSNY---IQLVWDHSYKVGCAV----TPCSKIGHIIHAAIFICNYAPGGTLTRRPYEP 205

  Fly   232 GKPASEC-RTGSNPEYPALCS 251
            |...:.| |.....::  |||
Human   206 GIFCTRCGRRDKCTDF--LCS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 40/169 (24%)
GLIPR1L2NP_001257325.1 SCP_GLIPR-1_like 52..195 CDD:240185 44/177 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.