DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and Crisp3

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:257 Identity:60/257 - (23%)
Similarity:89/257 - (34%) Gaps:60/257 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNEHNK-RR 75
            :|::..:|:..|     |.|..||:            :..|.:......|..::.||::||: ||
Mouse     4 MLVLFFLAAVLP-----PSLLQDNS------------QENSLEKLSTSKKSVQEEIVSKHNQLRR 51

  Fly    76 NYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNL--GQNLCGVDRR 138
            ....|||        .:..|.|:.:.:..|......|...|...  ..|..||  |:||......
Mouse    52 KVSPSGS--------DLLNMEWNYDAQVNAQQRADKCTFSHSPI--ELRTTNLKCGENLFMSSYL 106

  Fly   139 RNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTN 203
            ..|...:.....:|.||.||.....:.|.:            ||..:.|...|..|.|.:...  
Mouse   107 VPWSSVIQGWYNESKGLIFGVGPKQNVSVV------------GHHTQVVWKSNLQVACGVAEC-- 157

  Fly   204 PQYPFLYIYNTACNYASV--YAIGVP-----VYNAGKPASECRTGSNPE--YPALCSIKEQY 256
            |:.|..|.|  .|.|..|  |:...|     .|.|..|.:.|     |:  ...||:...||
Mouse   158 PENPLRYFY--VCRYCPVLNYSGHYPSRPYLAYTARAPCASC-----PDRCEDGLCTKSCQY 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 38/157 (24%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 39/160 (24%)
Crisp 194..241 CDD:285731 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.