DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and Crisp1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:194 Identity:48/194 - (24%)
Similarity:76/194 - (39%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIA-SGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNL-- 128
            ||::||:.|..:: |||        .:..|.|:.:.:..|......|...|...  ..|..||  
Mouse    42 IVSKHNQLRRMVSPSGS--------DLLKMEWNYDAQVNAQQWADKCTFSHSPI--ELRTTNLRC 96

  Fly   129 GQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTH 193
            |:||.......:|...:..        |:.|:|  |.:|....|....:  .||:.:.|.:....
Mouse    97 GENLFMSSYLASWSSAIQG--------WYNEYK--DLTYDVGPKQPDSV--VGHYTQVVWNSTFQ 149

  Fly   194 VGCAMMRFTNPQYPFLYIYNTACNYASV--Y--AIGVPVYNAGKPASECRTGSNPEY--PALCS 251
            |.|.:...  |:.|..|.|  .|:|..|  |  .:..| |.||:|.:.|     |::  ..||:
Mouse   150 VACGVAEC--PKNPLRYYY--VCHYCPVGNYQGRLYTP-YTAGEPCASC-----PDHCEDGLCT 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 36/154 (23%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 37/155 (24%)
Crisp 190..244 CDD:285731 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841445
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.