Sequence 1: | NP_611581.1 | Gene: | CG9822 / 37440 | FlyBaseID: | FBgn0034623 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006842.2 | Gene: | GLIPR1 / 11010 | HGNCID: | 17001 | Length: | 266 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 51/196 - (26%) |
---|---|---|---|
Similarity: | 77/196 - (39%) | Gaps: | 36/196 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 PDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHD 117
Fly 118 ----DCHNSY-RFRNLGQNLCGVDRRRNWDLNVTNL-VEQSMGLWFGEHKLIDSSYITDFKLTKD 176
Fly 177 LEKY-GHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTA---CNYASVYAIGVPVYNAGKPASE 237
Fly 238 C 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9822 | NP_611581.1 | SCP_euk | 64..219 | CDD:240180 | 44/164 (27%) |
GLIPR1 | NP_006842.2 | SCP_GLIPR-1_like | 32..178 | CDD:240185 | 45/168 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165151236 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.750 |