DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and CRISP3

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:175 Identity:43/175 - (24%)
Similarity:68/175 - (38%) Gaps:25/175 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQN 131
            |||:||:.|..::.       ||..|..|.|::|....|......|...|.:..:.......|:|
Human    73 IVNKHNELRRAVSP-------PARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGEN 130

  Fly   132 LCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGC 196
            |.......:|        .|::..||.|:.  |..:....|....:  .||:.:.|...:..|||
Human   131 LYMSSASSSW--------SQAIQSWFDEYN--DFDFGVGPKTPNAV--VGHYTQVVWYSSYLVGC 183

  Fly   197 AMMRFTNP---QYPFLYIYNTACNYASVYAIGVPVYNAGKPASEC 238
            ......|.   :|.::..|..|.|:|:  .:.|| |..|.|.:.|
Human   184 GNAYCPNQKVLKYYYVCQYCPAGNWAN--RLYVP-YEQGAPCASC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 36/154 (23%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.