DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and CG42780

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster


Alignment Length:250 Identity:88/250 - (35%)
Similarity:127/250 - (50%) Gaps:21/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIILGMASSQPLSWCDPDLCPDNTVHIACNN-DGKFHESCSPDATMVDLK-PYRKLIVNEHNKRR 75
            |::..:|.    ::|..|||...|.||||.| :|.|..||..|||::.|. ..:..::..||..|
  Fly    13 LVLHSLAE----NFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVR 73

  Fly    76 NYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNL--CGVDRR 138
            ...|||.....:.|.:||.|.|:::||.||.||.|||.:.||:|||:.:||..||||  .|....
  Fly    74 QKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHA 138

  Fly   139 R----NWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLT--KDLEKYGHFVETVLDRNTHVGCA 197
            |    ..::.::.|.|.::..|.||.|.|.:.   |.|.|  ...|..||....:.:::..|||.
  Fly   139 RITKTKMNMTLSMLFEMAVQKWAGEEKDITAE---DLKKTTPNPPEVIGHLTVLINEKSNAVGCG 200

  Fly   198 MMRFTNPQYPFLYIYNTACNYASVYAIGVPVY-NAGKPASECRTGSNPEYPALCS 251
            ::.:...:   :..||.|||||....||..|| ...|...||..|.:.:||.||:
  Fly   201 LVAYNLGE---IRRYNLACNYAYTNVIGERVYEECAKAGIECAKGIDQKYPPLCA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 54/162 (33%)
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 54/162 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440520
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.