DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and LOC100536500

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:206 Identity:50/206 - (24%)
Similarity:79/206 - (38%) Gaps:47/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKFHES--CSPDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATL 107
            |..|.|  ||......:|...::.||:.||..|..:...       |:.|..|.|.:.:...|..
Zfish    19 GFLHMSAACSVTGVCTELSSVQQEIVDVHNAFRRAVQPS-------ASNMLKMSWSDAVAESARG 76

  Fly   108 NLKTCYLEHDDCHNSYRFRN---LGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYIT 169
            .:..|.:.|..  .|.|..|   :|:||.......:|    |::|:    .|..|        :.
Zfish    77 WINKCNMTHGP--PSSRMLNGYEMGENLFKATGISSW----TSVVD----AWHSE--------VN 123

  Fly   170 DFKL---TKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTACNYASVYAIG----VP 227
            ::|.   :.:.:..||:.:.|...:..||||:     .|....|.|  .|:|   |..|    ||
Zfish   124 NYKYPIGSINGQATGHYTQVVWYSSYEVGCAV-----TQCGSNYFY--GCHY---YRAGNFRTVP 178

  Fly   228 VYNAGKPASEC 238
            .|:.|.|.:.|
Zfish   179 PYSLGSPCASC 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 35/160 (22%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.