DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and crispld1

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:222 Identity:50/222 - (22%)
Similarity:83/222 - (37%) Gaps:73/222 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLG 129
            |||::.|||.|..:       |.||:.|..|:||.|||..|....:||..||...          
 Frog    63 KLILDLHNKLRGEV-------YPPASNMEFMIWDVELERSAEAWAETCLWEHGPA---------- 110

  Fly   130 QNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHK----LIDSSY--ITD--FKLTKDLEKY------ 180
                          ::..::.|::|..:|.::    .:.:.|  :.|  |...::.:.|      
 Frog   111 --------------DLLPVIGQNLGAHWGRYRPPTYHVQAWYDEVRDYTFPYPQECDPYCPFRCS 161

  Fly   181 ----GHFVETVLDRNTHVGCAM-----MRFTNPQYP-FLYIYNTACNYA-SVYAIGVPVYNAGKP 234
                .|:.:.|...::.:|||:     |......:| .:|:   .|||: .....|...|..|.|
 Frog   162 GPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYL---VCNYSPKGNWWGHAPYKHGHP 223

  Fly   235 ASEC--------------RTGSNPEYP 247
            .|.|              :.||:..||
 Frog   224 CSACPPSYGGGCKDNLCYKDGSDLHYP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 39/177 (22%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 39/177 (22%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.