Sequence 1: | NP_611581.1 | Gene: | CG9822 / 37440 | FlyBaseID: | FBgn0034623 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002937123.2 | Gene: | crispld1 / 100490431 | XenbaseID: | XB-GENE-989389 | Length: | 514 | Species: | Xenopus tropicalis |
Alignment Length: | 222 | Identity: | 50/222 - (22%) |
---|---|---|---|
Similarity: | 83/222 - (37%) | Gaps: | 73/222 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 KLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLG 129
Fly 130 QNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHK----LIDSSY--ITD--FKLTKDLEKY------ 180
Fly 181 ----GHFVETVLDRNTHVGCAM-----MRFTNPQYP-FLYIYNTACNYA-SVYAIGVPVYNAGKP 234
Fly 235 ASEC--------------RTGSNPEYP 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9822 | NP_611581.1 | SCP_euk | 64..219 | CDD:240180 | 39/177 (22%) |
crispld1 | XP_002937123.2 | CAP_CRISPLD1 | 62..207 | CDD:349407 | 39/177 (22%) |
LCCL | 304..388 | CDD:128866 | |||
LCCL | 407..506 | CDD:367672 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |