DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and pi15

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:196 Identity:57/196 - (29%)
Similarity:74/196 - (37%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQN 131
            ||..||:.|..:       :.||..|..|||||.|..||.....||..:|..   ||..:.||||
 Frog    70 IVEYHNQVRGKV-------FPPAANMEYMVWDENLAKLAEAWAATCIWDHGP---SYLLKFLGQN 124

  Fly   132 LCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYG----HFVETVLDRNT 192
            |   ..|.....::..||:.    |:.|.|.....|..:......|..||    |:.:.|.....
 Frog   125 L---SVRTGRYKSILQLVKP----WYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTN 182

  Fly   193 HVGCAMMRFTNPQY------PFLYIYNTACNYA-SVYAIGVPVYNAGKPASECRTGSNPEYPALC 250
            .:|||:....|...      ..:|:   .|||: ....||...|..|.|.|.|    .|.|...|
 Frog   183 RIGCAIHTCHNMNVWGAVWRRAVYL---VCNYSPKGNWIGEAPYTIGVPCSAC----PPSYGGSC 240

  Fly   251 S 251
            |
 Frog   241 S 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 45/161 (28%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.