DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and crispld1a

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:207 Identity:55/207 - (26%)
Similarity:80/207 - (38%) Gaps:59/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQN 131
            |::.|||.|..:       |.||:.|..||||.|||..|....:||..||..   :.....:|||
Zfish    70 ILDLHNKLRGQV-------YPPASNMEYMVWDNELERSAEEWAETCLWEHGP---AGLLPQIGQN 124

  Fly   132 LCGVDRRRNWD--LNVTNLVEQSMGLWFGEHKLIDSSYITD------FKLTKDLEKYGHFVETVL 188
            | ||    :|.  ...|:.|:    .|:.|.|.....|..:      |:.:..:  ..|:.:.|.
Zfish   125 L-GV----HWGRYRPPTSHVQ----AWYDEVKDYSFPYPQECNPHCPFRCSGPV--CTHYTQLVW 178

  Fly   189 DRNTHVGCAMMRFTNPQYPF----------LYIYNTACNYASV-----YAIGVPVYNAGKPASEC 238
            ..::.:|||:    |..|..          :|:   .|||:..     ||    .|..|...|.|
Zfish   179 ATSSRIGCAI----NVCYNMNVWGQIWAKAVYL---VCNYSPKGNWWGYA----PYKHGTSCSAC 232

  Fly   239 RTGSNPEYPALC 250
                .|.|..:|
Zfish   233 ----PPSYGGVC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 45/169 (27%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 45/169 (27%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585684
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.