DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and XB5812873

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:311 Identity:69/311 - (22%)
Similarity:102/311 - (32%) Gaps:111/311 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEYGRFQTVG------CL----------------LIILGMAS-SQPLSWCDPDLCPDNTVHIACN 42
            |:.||..|:.      |:                |::|.:|| |:|.|       ..::|.    
 Frog     1 MDGGRMDTMAFGAGAYCIPRSFHNLSSFLEMNGFLLLLCLASLSKPTS-------EQDSVE---- 54

  Fly    43 NDGKFHESCSPDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATL 107
                     |.|....||:..|..||::||..|:::..       ||..|..|.||.  .|||..
 Frog    55 ---------SFDEMSTDLESNRNFIVDKHNYYRSWVNP-------PAADMLKMHWDN--YYLAKA 101

  Fly   108 N--LKTCYLEHDD-CHNSYRFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYIT 169
            .  ..||..:|.: ....|.....|:|:.....|.:|        |..:..||.||  ::..|..
 Frog   102 KEWALTCSFKHSNLSFRQYGGEFAGENIMNSYFRHSW--------EYVINYWFNEH--VNWEYAV 156

  Fly   170 DFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLY--IY----------------NTAC 216
            .  .||:....|||.:.:......:.|.:.:.....|.:.|  ||                .|.|
 Frog   157 G--TTKEGAVTGHFTQIIWAPTHALACYVAKCYGTPYNYFYVCIYYPTGNREDKVKTPYQNGTTC 219

  Fly   217 -------------NYASVYAIGVPVYNAGKPASECRTGSNPEYPALCSIKE 254
                         ||.       |.||:   |..|.|..|   .:||...:
 Frog   220 GLCQKDCDDQLCLNYC-------PYYNS---AGNCGTDKN---ASLCDYSD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 42/188 (22%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 39/156 (25%)
Crisp 219..269 CDD:400739 12/52 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.