DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA10 and Shawl

DIOPT Version :9

Sequence 1:NP_005540.1 Gene:KCNA10 / 3744 HGNCID:6219 Length:511 Species:Homo sapiens
Sequence 2:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster


Alignment Length:563 Identity:167/563 - (29%)
Similarity:258/563 - (45%) Gaps:165/563 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    83 EGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQFFDSMRNEYFFDRNRPSFDGILYYYQS 147
            :|..|:|:|::|:|:||...||.:.|.|.|....:.:..:|.:.|||||||:...|..||.||::
  Fly     2 DGENRIILNVSGIRYETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFTQILNYYRT 66

Human   148 GGKIRRPANVPIDIFADEISFYELGSEAMDQ--------FREDEGFIK-----DPETLLPTND-- 197
             ||:..|.:|...:|.:|:.|:.|.|..::.        .|:.:..:.     |.|...||.:  
  Fly    67 -GKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTLAILDKLDIENEKPTEEQI 130

Human   198 --------------------IHRQFWLLFEYPESSSAARAVAVVSVLVVVISITIFCLETLPEFR 242
                                |..:.|.:|:.|.||:.|:.||.:||..:.:|:..|||:|.|.||
  Fly   131 ARLFGFEEALSNGELNCWQRIKPKIWAMFDEPSSSTGAKIVAGMSVFFIFVSVISFCLKTHPGFR 195

Human   243 ED--------------------------------------------------------------- 244
            .|                                                               
  Fly   196 VDLPSGAHDAHGPGAGGPPHGHDPMGEPPQTHQYHQHSITPPSGSIGPTFRVTNYTSYSSGNFTA 260

Human   245 ---------------RELKVVRDPNLNMSKTVLSQTM------------------FTDP---FFM 273
                           :.||      .|::.::|::.:                  :..|   ||.
  Fly   261 SGQATPIATIKGGQRQRLK------RNINGSILNEFIEEKILGHNGRRKHGWIETYGQPHEAFFY 319

Human   274 VESTCIVWFTFELVLRFVVCPSKTDFFRNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLA 338
            ||..|.|||..|:::|.:|.|:...|.::.:||||..:.:.::..::..:.:.|          .
  Fly   320 VELVCNVWFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFYTDVMQRMGEYT----------G 374

Human   339 ILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE--VDEP 401
            :|....:||:.|:|||:|||.||:||..|.|||.:||.||:|||.:|::.|:|..|:||  .|.|
  Fly   375 LLEAFSIVRIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAEKLQDNP 439

Human   402 ESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHR 466
            ::.|.|||.|.|||:||||||||||:.|.|..|..||.|||:|||||||||||||||||:.||  
  Fly   440 DNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFY-- 502

Human   467 ETENEEKQNIPGEIERIL---------NSVGSRMGSTDSLNKT 500
             :..:.:..:|.:..|:|         .......|.|:::.:|
  Fly   503 -SHTQARSKLPKKRRRVLPVEQPRRKREPTAPHRGRTNAIKQT 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA10NP_005540.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..50
BTB_2 88..179 CDD:308049 33/98 (34%)
Ion_trans 255..467 CDD:306908 99/234 (42%)
Selectivity filter. /evidence=ECO:0000250 421..426 4/4 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..511 3/12 (25%)
ShawlNP_001097131.2 BTB 7..99 CDD:197585 33/92 (36%)
BTB_2 7..97 CDD:280393 33/90 (37%)
Ion_trans 307..506 CDD:278921 97/211 (46%)
Ion_trans_2 <449..499 CDD:285168 38/49 (78%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.