DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA10 and RpL37b

DIOPT Version :9

Sequence 1:NP_005540.1 Gene:KCNA10 / 3744 HGNCID:6219 Length:511 Species:Homo sapiens
Sequence 2:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster


Alignment Length:38 Identity:11/38 - (28%)
Similarity:16/38 - (42%) Gaps:11/38 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   350 RIFKLSRHSKG-----------LQILGQTLKASMRELG 376
            |.|..||.:||           |:.|.:..:..:||.|
  Fly    45 RSFNWSRKAKGRKAQGTGRMRYLKNLRRRFRNGLREGG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA10NP_005540.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..50
BTB_2 88..179 CDD:308049
Ion_trans 255..467 CDD:306908 11/38 (29%)
Selectivity filter. /evidence=ECO:0000250 421..426
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..511
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.