DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA10 and CG1688

DIOPT Version :9

Sequence 1:NP_005540.1 Gene:KCNA10 / 3744 HGNCID:6219 Length:511 Species:Homo sapiens
Sequence 2:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster


Alignment Length:139 Identity:31/139 - (22%)
Similarity:55/139 - (39%) Gaps:19/139 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   385 GVILF----SSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTLCAIAG 445
            |..||    :||:.....|..:|...|..:...::|..:||:|:|.:.|.|..||:.....|:.|
  Fly   166 GAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVG 230

Human   446 V----LTIALPVPVIVSNFNYFYHR------ETENEEKQNIPG-EIERILNSVGSRMGSTDSLNK 499
            |    :.::....::.......|.|      ..:...:::.|| ......::..||...||..:|
  Fly   231 VPLMLMCLSSLGALLADGLQCTYVRLCCQLQRHQEHRRKSTPGTSTPSASSAANSREKDTDKRSK 295

Human   500 TN----GGC 504
            ..    .||
  Fly   296 RRMANCKGC 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA10NP_005540.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..50
BTB_2 88..179 CDD:308049
Ion_trans 255..467 CDD:306908 22/95 (23%)
Selectivity filter. /evidence=ECO:0000250 421..426 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..511 7/20 (35%)
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 13/55 (24%)
Ion_trans_2 822..896 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.