DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCR3LG1 and Ncr3lg1

DIOPT Version :9

Sequence 1:NP_001189368.1 Gene:NCR3LG1 / 374383 HGNCID:42400 Length:454 Species:Homo sapiens
Sequence 2:XP_017445618.1 Gene:Ncr3lg1 / 691092 RGDID:1588614 Length:379 Species:Rattus norvegicus


Alignment Length:311 Identity:126/311 - (40%)
Similarity:179/311 - (57%) Gaps:28/311 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    12 ALLILLWA-LTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFD-K 74
            :||:|||: |.:.|.|::| |||.|||..|:::|||.|.|..|..|:::.:|:.|   ||..| .
  Rat    71 SLLLLLWSLLPSAGGLELE-MAGTTQIVFLHEDVTIPCKILGSLHLDLSIVGVIW---SLKKDGD 131

Human    75 EVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEV 139
            |.:||:|:||..||.||||.||...|:.|||||.||..:|.|||||:|:|||||.|.:||.:|||
  Rat   132 ESEVFKFYGDQLEAVRPGANVSLLGLEHGDASLYLPRFELWEAGEYQCKVVVTPEKKEGTTRLEV 196

Human   140 VASPASRLLLDQVGMKENEDK-YMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNM 203
            ||.|...|.......:..::| .:|:..||||||::|.|.....|..|..||:|.|:||||:||.
  Rat   197 VAHPNMSLSEKPATARGGKEKLIICQLDGFYPEALDIKWMGSALKDSHFQEITEGVVTGPTVKND 261

Human   204 DGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWP- 267
            ||||:|||.|.|..:.||  .:|||||.|.|...|  .:..:|...::...|..|...:....| 
  Rat   262 DGTFSVTSSLALKPALED--HMYQCVVWHRSWLMP--QSLNVTVFENTRDSTHGTVPPTAEVGPP 322

Human   268 ----------ISFIGVGLVLLIVLI----PWKKICNKSSSAYTPL--KCIL 302
                      ::.||:.::|..|::    .||::...::.....|  :|.|
  Rat   323 VSEPRSVMIYVTIIGLCILLFSVIVCGLWKWKRLTTSNTGLCLRLDVRCCL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCR3LG1NP_001189368.1 Ig 42..135 CDD:325142 48/93 (52%)
Interaction with NCR3. /evidence=ECO:0000269|PubMed:19528259 59..62 0/2 (0%)
Ig 105..240 CDD:325142 68/135 (50%)
Interaction with NCR3. /evidence=ECO:0000269|PubMed:19528259 127..130 2/2 (100%)
Retroviral-Gag-like 291..429 3/14 (21%)
Gag_MA 296..>377 CDD:307339 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..454
Ncr3lg1XP_017445618.1 IG_like 94..196 CDD:214653 54/104 (52%)
Ig 99..197 CDD:299845 52/100 (52%)
IgC 203..299 CDD:143166 42/99 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.500

Return to query results.
Submit another query.