DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCR3LG1 and zgc:123297

DIOPT Version :9

Sequence 1:NP_001189368.1 Gene:NCR3LG1 / 374383 HGNCID:42400 Length:454 Species:Homo sapiens
Sequence 2:NP_001032650.1 Gene:zgc:123297 / 641563 ZFINID:ZDB-GENE-051127-9 Length:318 Species:Danio rerio


Alignment Length:159 Identity:42/159 - (26%)
Similarity:72/159 - (45%) Gaps:42/159 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    40 LNDNVTIFCNIFYSQP-LNITSMGITWFWKSLTFDKEVKVFEFFGDHQ-------EAFRPGA-IV 95
            :.|:|.:.|:   .:| :::..|.:.|....|. |..|.::|   ||:       |::|... ::
Zfish    35 VGDDVILPCS---GKPNISVVDMRVEWRRSDLK-DSLVHLYE---DHEDRETEQNESYRGRTQLI 92

Human    96 SPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVA------------SPASRLL 148
            .| .|:.|:|||||..:::.:.|.|:|.:.....|.:.||.|.|.|            :|:..|.
Zfish    93 HP-ELQRGNASLRLSSVKVSDEGRYKCIIGSESSKHEATVDLTVEALGWPPVITIDGFNPSGGLR 156

Human   149 LDQVGMKENEDKYMCESSGFYPEAINITW 177
            |            .|||.|:|||. ::.|
Zfish   157 L------------QCESEGWYPEP-HLEW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCR3LG1NP_001189368.1 Ig 42..135 CDD:325142 26/101 (26%)
Interaction with NCR3. /evidence=ECO:0000269|PubMed:19528259 59..62 0/2 (0%)
Ig 105..240 CDD:325142 25/85 (29%)
Interaction with NCR3. /evidence=ECO:0000269|PubMed:19528259 127..130 0/2 (0%)
Retroviral-Gag-like 291..429
Gag_MA 296..>377 CDD:307339
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..454
zgc:123297NP_001032650.1 IG_like 33..135 CDD:214653 29/107 (27%)
Ig 36..135 CDD:299845 29/106 (27%)
Ig 141..224 CDD:299845 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.