DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCR3LG1 and dhrs13b.2

DIOPT Version :9

Sequence 1:NP_001189368.1 Gene:NCR3LG1 / 374383 HGNCID:42400 Length:454 Species:Homo sapiens
Sequence 2:NP_001077299.1 Gene:dhrs13b.2 / 559844 ZFINID:ZDB-GENE-080303-14 Length:436 Species:Danio rerio


Alignment Length:222 Identity:58/222 - (26%)
Similarity:100/222 - (45%) Gaps:25/222 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    67 WKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKA 131
            |:.....:..|:|.:.....::...|..|.  .:..|:||.:|...:....|.|.|.|:|.||..
Zfish   216 WRLQRHGERTKLFSYSSRTGKSEGKGVTVK--TIAGGNASFKLEPTRKHSEGTYVCSVMVPPLYG 278

Human   132 QGTVQLEVVASPASRLLL-DQVGMKENED-KYMCESSGFYPEAINITWEKQTQKFPH-----PIE 189
            ...:.|.:...|...|.: ..:.|...:| |.:||:..:||..::|.|.::    ||     |:.
Zfish   279 SHDIPLSLSEQPRVSLNVGSTLSMVIGQDQKLICEAESYYPLDVDIEWYRE----PHGGSPTPLF 339

Human   190 ISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSE 254
            :...:.:...| :.|||:::::...|....||.|..|.|.|.|.||.||:|.:|.|.|     :|
Zfish   340 LKNVLYSSHRI-HQDGTYSLSAFFYLQPGLEDSGYKYTCRVSHKSLLTPVRKSFYLVA-----TE 398

Human   255 TEKTDNFSIHWWPISFIGVGLVLLIVL 281
            .:.|      .|.|:..|..:.:|::|
Zfish   399 PDST------MWYIAVFGFIIAMLVIL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCR3LG1NP_001189368.1 Ig 42..135 CDD:325142 16/67 (24%)
Interaction with NCR3. /evidence=ECO:0000269|PubMed:19528259 59..62
Ig 105..240 CDD:325142 41/141 (29%)
Interaction with NCR3. /evidence=ECO:0000269|PubMed:19528259 127..130 1/2 (50%)
Retroviral-Gag-like 291..429
Gag_MA 296..>377 CDD:307339
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..454
dhrs13b.2NP_001077299.1 Ig 185..275 CDD:299845 14/60 (23%)
IgC_Tapasin_R 252..391 CDD:143248 42/143 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.