DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCR3LG1 and Sirpa

DIOPT Version :10

Sequence 1:NP_001189368.1 Gene:NCR3LG1 / 374383 HGNCID:42400 Length:454 Species:Homo sapiens
Sequence 2:NP_001277948.1 Gene:Sirpa / 19261 MGIID:108563 Length:513 Species:Mus musculus


Alignment Length:377 Identity:75/377 - (19%)
Similarity:125/377 - (33%) Gaps:140/377 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    22 TEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQ 86
            |:.:..|.:.||        |:..:.|.:....|:.    .|.|:  .......:.::.|.|::.
Mouse    37 TQPEKSVSVAAG--------DSTVLNCTLTSLLPVG----PIRWY--RGVGPSRLLIYSFAGEYV 87

Human    87 EAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRC-------EVVVTPLKAQGTVQLEV----- 139
            ...|  .:....:..:.|.|:|:..:...:||.|.|       ....|.:::.|..::.|     
Mouse    88 PRIR--NVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPS 150

Human   140 ---VASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIE------------ 189
               |:.||.|      |:.:.:..:.|:|.||.|..|.:.|.|..|:. ||:|            
Mouse   151 PPEVSGPADR------GIPDQKVNFTCKSHGFSPRNITLKWFKDGQEL-HPLETTVNPSGKNVSY 208

Human   190 --------------------------------------ISEDVITGPTI---------------- 200
                                                  :|..:...||:                
Mouse   209 NISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLT 273

Human   201 -------------------------------KNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHAS 234
                                           ||.|||:|.||...:|||......|:.|.|:|..
Mouse   274 CRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQ 338

Human   235 LHTPLRSNFTLTAARHSLSETEKT--DNFSIHWWPISFIGVGL--VLLIVLI 282
            .....|::..|..|..|...:.:|  ||.:.|.|.: |||||:  .||:||:
Mouse   339 QPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNV-FIGVGVACALLVVLL 389

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
NCR3LG1NP_001189368.1 IgV_B7-H6 26..139 CDD:409573 20/119 (17%)
FR1 26..50 CDD:409573 5/23 (22%)
Ig strand A 26..31 CDD:409573 1/4 (25%)
Ig strand A' 35..38 CDD:409573 0/2 (0%)
Ig strand B 41..51 CDD:409573 2/9 (22%)
CDR1 51..61 CDD:409573 1/9 (11%)
Interaction with NCR3. /evidence=ECO:0000269|PubMed:19528259 59..62 0/2 (0%)
Ig strand C 61..68 CDD:409573 2/6 (33%)
FR2 62..68 CDD:409573 2/5 (40%)
CDR2 69..88 CDD:409573 2/18 (11%)
Ig strand C' 76..81 CDD:409573 0/4 (0%)
Ig strand C' 85..88 CDD:409573 0/2 (0%)
FR3 89..124 CDD:409573 8/41 (20%)
Ig strand D 93..98 CDD:409573 0/4 (0%)
Ig strand E 104..111 CDD:409573 3/6 (50%)
Ig strand F 117..125 CDD:409573 4/14 (29%)
CDR3 125..130 CDD:409573 1/4 (25%)
Interaction with NCR3. /evidence=ECO:0000269|PubMed:19528259 127..130 1/2 (50%)
FR4 131..139 CDD:409573 1/7 (14%)
Ig strand G 131..139 CDD:409573 1/7 (14%)
IgC1 138..243 CDD:409354 37/209 (18%)
Ig strand A 138..143 CDD:409354 2/12 (17%)
Ig strand B 159..166 CDD:409354 1/6 (17%)
Ig strand C 172..178 CDD:409354 1/5 (20%)