DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30394 and AVT1

DIOPT Version :9

Sequence 1:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_012534.1 Gene:AVT1 / 853457 SGDID:S000003761 Length:602 Species:Saccharomyces cerevisiae


Alignment Length:418 Identity:95/418 - (22%)
Similarity:163/418 - (38%) Gaps:51/418 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLAHSAHVMTLANSI---IGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCHYLIKTSLLTRR 62
            :...|....|:.|||   ||:|:||:|...:..|.::.:.:|.:. .:...|...|:...|.|..
Yeast   204 LAGQSTAPQTIFNSINVLIGIGLLALPLGLKYAGWVIGLTMLAIF-ALATFCTAELLSRCLDTDP 267

  Fly    63 R--SFEMLGLHAFGTSGKLLVELCIIGYLIGTCITYFVVVGD----LGPQIIAKIFALDVADHLH 121
            .  |:..||..||||.|:.|:.......|:|:.::..::.||    |.||.....|.:       
Yeast   268 TLISYADLGYAAFGTKGRALISALFTLDLLGSGVSLVILFGDSLNALFPQYSTTFFKI------- 325

  Fly   122 LRSLVMVVVTVVCIVPLGMLRNVDSLSAVCTASIGFYVCLILKIVLEAQPHITANDWTEKVLYWE 186
               :...:||....:||.:|.|:..|..:.|......:| ...:...:.|....|.....:  | 
Yeast   326 ---VSFFIVTPPVFIPLSVLSNISLLGILSTTGTVLVIC-CCGLYKSSSPGSLVNPMETSM--W- 383

  Fly   187 PAGVLQ-CLPIFSMALSCQMQLFEVFESINN--QSLDKLNGIVRNATWICTFVYISVGFFGYVAF 248
            |..:.. ||.|  ..||.......||.::..  :..||....::....|.:...|.....|::.|
Yeast   384 PIDLKHLCLSI--GLLSACWGGHAVFPNLKTDMRHPDKFKDCLKTTYKITSVTDIGTAVIGFLMF 446

  Fly   249 CTHTFSGN-----ILVNLSTSFGSDIIKIGFVLSIAFSFPLVIFPCRA----SLYSLLYRKGH-T 303
                  ||     |..|:..:.|......|.:.::....|:...|..|    |:..:|....| .
Yeast   447 ------GNLVKDEITKNVLLTEGYPKFVYGLISALMTIIPIAKTPLNARPIVSVLDVLMNVQHID 505

  Fly   304 ESSSYIPEQRFR----FITIFIVVFSLCVALVIPSVELIIGLVGSTIGVAICIMFPASSFRKIIK 364
            |::|.|..:..:    |..|||.|..:.:|:..|..:.||..:|:.:...||::.|...:.::.|
Yeast   506 EAASAIKRRAAKGLQVFNRIFINVVFVLIAINFPEFDKIIAFLGAGLCFTICLILPCWFYLRLCK 570

  Fly   365 K--ESMERTLAQFVFVSGFLLMILGTYA 390
            .  :..||...........:|..||..|
Yeast   571 TTIKPWERVACHVTICISVVLSTLGVGA 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30394NP_611578.1 SdaC 8..392 CDD:223884 94/411 (23%)
SLC5-6-like_sbd 8..390 CDD:294310 93/409 (23%)
DUF4775 <394..652 CDD:292620
YukC <561..660 CDD:295067
AVT1NP_012534.1 Aa_trans 206..601 CDD:279788 95/416 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.