DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30394 and AT5G38820

DIOPT Version :9

Sequence 1:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_001330273.1 Gene:AT5G38820 / 833873 AraportID:AT5G38820 Length:461 Species:Arabidopsis thaliana


Alignment Length:423 Identity:107/423 - (25%)
Similarity:198/423 - (46%) Gaps:53/423 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAHVMTLANSIIGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCHYLIKTSLLTRRRSFEMLG 69
            |..|..||.:|||.||:|:|...:..|::..|.::||...:|.....:|::.|.:..:||:..:.
plant    43 SGAVFNLATTIIGAGIMALPATMKILGLIPGITIIVLMAFLTDASIEFLLRFSNIGNQRSYGGVM 107

  Fly    70 LHAFGTSGKLLVELCIIGYLIGTCITYFVVVGDLGPQIIA--KIFALDVADHL---------HLR 123
            ..:||..|::::::.|:...||..|.|.:::||    ::|  ..:.:..|..|         :.|
plant   108 DDSFGKCGRIMLQVSILVSNIGVLIVYMIIIGD----VLAGKNEYGIHHAGMLEGWFGISWWNRR 168

  Fly   124 SLVMVVVTVVCIVPLGMLRNVDSL---SAVCTA-SIGFYV----CLILKIVLEA--QPHITANDW 178
            :.|::|.|:....||...:.:|||   ||:..| ::.|.|    ..|:|:..:.  .|.:..| .
plant   169 TFVLLVTTLTVFAPLTCFKRIDSLRFTSAISVALAVVFLVITAGITIIKLFTDGLMMPRLLPN-V 232

  Fly   179 TEKVLYWEPAGVLQCLPIFSMALSCQMQLFEVFESINNQSLD--KLNGIVRNATWICTFVYISVG 241
            |:...:|:   :...:|:...|..|...:    .||.|:..|  ::..:||:|..:|:.||:...
plant   233 TDLSSFWK---LFTVVPVLVNAYICHYNV----HSIQNELEDPSRIKPVVRSALAMCSSVYVMTS 290

  Fly   242 FFGYVAFCTHTFSGNILVNLSTSFG-------SDIIKIGFVLSIAFSFPLVIFPCRASLYSLLYR 299
            .|||:.|...|.. ::|.|..|..|       :|.::..:...:...||:|.:|.|.::..|::.
plant   291 LFGYLLFGDGTLD-DVLANFDTDLGIPFGSVLNDAVRFSYAAHLMLVFPVVFYPLRINIDGLIFP 354

  Fly   300 KGHTESSSYIPEQRFRFITIFIVVFSLCVALVIPSVELIIGLVGSTIGVAICIMFPASSFRKIIK 364
            .....:||. .:.||..||..::......|..|||:.......|:|..|.|..:|||:...|...
plant   355 TAPPLTSSE-SDLRFGSITAGLIAVIFLGANFIPSIWDAFQFTGATAAVCIGFIFPAAVILKDRH 418

  Fly   365 KESMER--TLAQFVFVSGFLLMILGTYANLSAI 395
            .::.:|  |:|       ..:::|..::|..||
plant   419 NQATKRDKTIA-------ICMIVLAVFSNAIAI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30394NP_611578.1 SdaC 8..392 CDD:223884 103/415 (25%)
SLC5-6-like_sbd 8..390 CDD:294310 103/413 (25%)
DUF4775 <394..652 CDD:292620 2/2 (100%)
YukC <561..660 CDD:295067
AT5G38820NP_001330273.1 SLC5-6-like_sbd 39..446 CDD:382020 107/423 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1495
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2742
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.