DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30394 and SLC38A1

DIOPT Version :9

Sequence 1:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens


Alignment Length:409 Identity:106/409 - (25%)
Similarity:183/409 - (44%) Gaps:66/409 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VMTLANSIIGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCHYLIKTSLLTRRRSFEMLGLHA 72
            |..|:|:|:|.|||.:.|.....||||.:|||.....::....:.|:..|..|....:|.||...
Human    77 VFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSKETGCMVYEKLGEQV 141

  Fly    73 FGTSGKLLVELCIIGYLIGTCITYFVVVGDLGPQIIAKIFALD---VADHLHLRSLVMVVVTVVC 134
            |||:||.::.........|..::|..:|.:..|..|..:...:   .|.::..|.|| |:||...
Human   142 FGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLV-VIVTFGI 205

  Fly   135 IVPLGMLRNVDSLSAVCTASIG----FYVCLILK------IVLEAQPHITAND------------ 177
            |:||.:|:|:..|......|:.    |.:.:|.|      ||.|....|:||.            
Human   206 ILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTNADTCTPKYVT 270

  Fly   178 WTEKVLYWEPAGVLQCLPIFSMALSCQMQLFEVFESINNQSLDKLNGIVRNATWICTFV-YISVG 241
            :..|.:|        .||..:.|..|...:..::..:.::|..|:. :|.|.::...|| |....
Human   271 FNSKTVY--------ALPTIAFAFVCHPSVLPIYSELKDRSQKKMQ-MVSNISFFAMFVMYFLTA 326

  Fly   242 FFGYVAFCTHTFSGNILVNLSTSFGS--DI----IKIGFVLSIAFSFPLVIFPCRASLYSLLYRK 300
            .|||:     ||..|:..:|...:.|  ||    :::..::::..:.|::.|..|:||:.|..:.
Human   327 IFGYL-----TFYDNVQSDLLHKYQSKDDILILTVRLAVIVAVILTVPVLFFTVRSSLFELAKKT 386

  Fly   301 -----GHTESSSYIPEQRFRFIT-IFIVVFSLCVALVIPSVELIIGLVGSTIGVAICIMFPASSF 359
                 .||            .:| |.:||.:|.| :.|||::.|.|:||.|....:..:.|:|.:
Human   387 KFNLCRHT------------VVTCILLVVINLLV-IFIPSMKDIFGVVGVTSANMLIFILPSSLY 438

  Fly   360 RKIIKKESMERTLAQFVFV 378
            .||..::..:.|...::|:
Human   439 LKITDQDGDKGTQRIWLFL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30394NP_611578.1 SdaC 8..392 CDD:223884 106/409 (26%)
SLC5-6-like_sbd 8..390 CDD:294310 106/409 (26%)
DUF4775 <394..652 CDD:292620
YukC <561..660 CDD:295067
SLC38A1NP_001265319.1 SLC5-6-like_sbd 69..480 CDD:382020 106/409 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.