DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30394 and Slc38a3

DIOPT Version :9

Sequence 1:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_001186146.1 Gene:Slc38a3 / 76257 MGIID:1923507 Length:505 Species:Mus musculus


Alignment Length:441 Identity:93/441 - (21%)
Similarity:186/441 - (42%) Gaps:88/441 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VMTLANSIIGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCHYLIKTSLLTRRRSFEMLGLHA 72
            |..|:|:|:|.|||.:.:.....||:|.:.||.....::....|.|:|:|.:...|::|.||..|
Mouse    71 VFNLSNAIMGSGILGLAYAMANTGIILFLFLLTAVALLSSYSIHLLLKSSGIVGIRAYEQLGYRA 135

  Fly    73 FGTSGKLLVELCIIGYLIGTCITYFVVVGDLGPQII---------AKIFALDVADHLHLRSLVMV 128
            |||.|||...|.|....||...:|..::....|.:|         |.::.:|       .:.:::
Mouse   136 FGTPGKLAAALAITLQNIGAMSSYLYIIKSELPLVIQTFLNLEKPASVWYMD-------GNYLVI 193

  Fly   129 VVTVVCIVPLGMLRNVDSLSAVCTASIGFYVCLILKIV--------------------------- 166
            :|:|..|:||.::|.:..|......|:...|..::.::                           
Mouse   194 LVSVTIILPLALMRQLGYLGYSSGFSLSCMVFFLIAVIYKKFQVPCPLAHNLANATGNFSHMVVA 258

  Fly   167 -----LEAQPHITANDWTEKVLYWEPAGVLQCLPIFSMALSCQMQLFEVFESINNQSLDKLNGIV 226
                 |:.:|...|..:.....:...:.....:||.:.|..|..::..::..:.:.|..|:..|.
Mouse   259 EEKAQLQGEPDTAAEAFCTPSYFTLNSQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKRKMQHIS 323

  Fly   227 RNATWICTFVYISVGFFGYVAF-------CTHTFSG----NILVNLSTSFGSDIIKIGFVLSIAF 280
            ..:..:...:|.....|||:.|       ..||:|.    ::|:.        .:::..::::..
Mouse   324 NLSIAVMYVMYFLAALFGYLTFYDGVESELLHTYSKVDPFDVLIL--------CVRVAVLIAVTL 380

  Fly   281 SFPLVIFPCRASLYSLLYRKGHTESSSYIPEQRFRFITIFIVVFSL--CVALVI---PSVELIIG 340
            :.|:|:||.|.::..:|::           .|.|.::...::...|  |:.|::   |::..|.|
Mouse   381 TVPIVLFPVRRAIQQMLFQ-----------NQEFSWLRHVLIATGLLTCINLLVIFAPNILGIFG 434

  Fly   341 LVGSTIGVAICIMFPASSFRKIIKKE-----SMERTLAQFVFVSGFLLMIL 386
            ::|:|....:..:|||..:.:|:..:     |..:.||......|||||.:
Mouse   435 IIGATSAPCLIFIFPAIFYFRIMPTDKEPARSTPKILALCFAAVGFLLMTM 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30394NP_611578.1 SdaC 8..392 CDD:223884 93/441 (21%)
SLC5-6-like_sbd 8..390 CDD:294310 93/441 (21%)
DUF4775 <394..652 CDD:292620
YukC <561..660 CDD:295067
Slc38a3NP_001186146.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..48
Aa_trans 63..492 CDD:279788 93/441 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.