DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30394 and CG32079

DIOPT Version :9

Sequence 1:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_729645.3 Gene:CG32079 / 39230 FlyBaseID:FBgn0052079 Length:457 Species:Drosophila melanogaster


Alignment Length:389 Identity:88/389 - (22%)
Similarity:155/389 - (39%) Gaps:87/389 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCHYLI----------KTSLLTRRRSFEM---L 68
            |.|.||||:.|...|.|:.::.............|.|:          ...:::.|::.|:   .
  Fly    60 GTGCLAMPYAFLNSGWLVGLICTFALGFFVLYAMHILLHHINNLGVQHNMPMISYRKAVELSIRK 124

  Fly    69 GLHAFGTSGK---LLVELCIIGYLIGTCITYFVVVG----DLGPQII----AKIFALDVADHLHL 122
            |...|....|   .||::.:..|..|....|.|.:.    .||...:    .:::...:|..|.|
  Fly   125 GPSIFHFLSKPFGYLVDILLCAYHFGVDCVYVVFIAKSLKHLGDMYLWVWDERLYMALIASPLIL 189

  Fly   123 RSLVMVVVTVVCIVPLGMLRNVDSLSAVCTASIGFYVCLILKIVLEAQPHITANDWTEKVLYWEP 187
            ..|:.   .:..:||..::.|:..|:       |:  |:||..:....|..      |.:...:|
  Fly   190 TFLIR---NLKSLVPFSIISNILLLT-------GY--CVILNYLFRDLPEF------EHLHAIQP 236

  Fly   188 AGVLQCLPIFSMALSCQMQLFEVFESINN-----QSLDKLNGIVRNATWICTFVYISVGFFGYVA 247
               |:..|||...:...::...|..|:..     :||....|::.....:....|...|||||..
  Fly   237 ---LRNFPIFFGTVLFSIESVGVILSLGRSMRKPESLMGTCGVLNQGMIVVISFYAVFGFFGYWR 298

  Fly   248 FCTHTFSGNILVNLSTSFGSDII-KIG---FVLSIAFSFPLVIFPCRASLYSLLYRKGHTESSSY 308
            :..:| |.:||.|:..   :||: |:.   |.|:|.||:.|..:    ....:::|       :|
  Fly   299 YGENT-SNSILQNMPQ---NDILPKLATGIFALAIFFSYALQGY----VTVDIIWR-------NY 348

  Fly   309 I-PEQRFRF-------ITIFIVVFSLCVALVIPSVELIIGLVGS----TIG------VAICIMF 354
            : ||...|:       :.|.:|:.|:.||:..|...|::.||||    .:|      |.||:.:
  Fly   349 LEPELEDRYLRTVECLLRIALVIASVLVAIQYPDFGLLLSLVGSFCLAQLGLILPGIVDICLRY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30394NP_611578.1 SdaC 8..392 CDD:223884 88/389 (23%)
SLC5-6-like_sbd 8..390 CDD:294310 88/389 (23%)
DUF4775 <394..652 CDD:292620
YukC <561..660 CDD:295067
CG32079NP_729645.3 SLC5-6-like_sbd 46..446 CDD:294310 88/389 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468290
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.