DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30394 and Slc32a1

DIOPT Version :9

Sequence 1:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_033534.2 Gene:Slc32a1 / 22348 MGIID:1194488 Length:525 Species:Mus musculus


Alignment Length:429 Identity:94/429 - (21%)
Similarity:174/429 - (40%) Gaps:91/429 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LANSIIGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCH--YLIKTSLLTRRRSFEMLGLH-- 71
            :.|:|.|:.:|.:|:.....| .|.:.|::.:   ..|||:  .::...|.......|::.:.  
Mouse   125 VTNAIQGMFVLGLPYAILHGG-YLGLFLIIFA---AVVCCYTGKILIACLYEENEDGEVVRVRDS 185

  Fly    72 -----------AFGTSGKLLVELCIIGYLIGTCITYFVVVGDL------GPQIIAKIFALDVADH 119
                       .|.|.|..:|.:..|..|:.|||.|.||.|:|      |..:..|.::      
Mouse   186 YVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQKSWS------ 244

  Fly   120 LHLRSLVMVVVTVVCIVPLGMLRN---VDSLSAVCTASIGFYVCLILKIVLEAQPHITANDWT-E 180
                    ::.|.| ::|...|:|   |...|.:||.:     ..::.|::.|.....|.||. |
Mouse   245 --------IIATAV-LLPCAFLKNLKAVSKFSLLCTLA-----HFVINILVIAYCLSRARDWAWE 295

  Fly   181 KVLYWEPAGVLQCLPIFSMALSCQMQLFEVFESINNQSLDKLNGIVRNAT-------WICTFVYI 238
            ||.::        :.:....:|..:.:|.....|   .|..|.|.::..:       |......:
Mouse   296 KVKFY--------IDVKKFPISIGIIVFSYTSQI---FLPSLEGNMQQPSEFHCMMNWTHIAACV 349

  Fly   239 SVGFFGYVAFCTHTFSGNILV--NLSTSFGSDIIKIGFVLSIAFSFPLVIFPCRASLYSLLYRKG 301
            ..|.|..||:.|.......::  ||..|..: ::.:..|.....|:||..|.....|...|:::|
Mouse   350 LKGLFALVAYLTWADETKEVITDNLPGSIRA-VVNLFLVAKALLSYPLPFFAAVEVLEKSLFQEG 413

  Fly   302 HTESSSYIP-----EQRFR----FITIFIVVFSLCVALVIPSVELIIGLVGSTIGVAICIMFPAS 357
               |.::.|     :.|.:    .:...:|||:|.:|:.:|...|::||.||..|..:|.:.|:.
Mouse   414 ---SRAFFPACYGGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSL 475

  Fly   358 SFRKIIKKESMER----TLAQFVF-----VSGFLLMILG 387
            ...:::.::.:..    .:|.||.     ||||:..:.|
Mouse   476 FHLRLLWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEG 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30394NP_611578.1 SdaC 8..392 CDD:223884 94/429 (22%)
SLC5-6-like_sbd 8..390 CDD:294310 94/429 (22%)
DUF4775 <394..652 CDD:292620
YukC <561..660 CDD:295067
Slc32a1NP_033534.2 Aa_trans 115..512 CDD:279788 93/425 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.