DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30394 and slc38a3a

DIOPT Version :9

Sequence 1:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_001092235.1 Gene:slc38a3a / 100073328 ZFINID:ZDB-GENE-070615-25 Length:189 Species:Danio rerio


Alignment Length:108 Identity:36/108 - (33%)
Similarity:57/108 - (52%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VMTLANSIIGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCHYLIKTSLLTRRRSFEMLGLHA 72
            |..|.|:|:|.|||.:.:.....||:|.::||.:..|::....|.|:|:|.:...|::|.||..|
Zfish    78 VFNLGNAIMGSGILGLAYAMANTGIVLFVILLTVVAGLSAYSIHLLLKSSGVVGIRAYEQLGYRA 142

  Fly    73 FGTSGKLLVELCIIGYLIGTCITYFVVVGDLGPQIIAKIFALD 115
            |||.||:...:.|....||...:|..:|....|.:|.....:|
Zfish   143 FGTPGKMAAGIAITLQNIGAMSSYLYIVKYEFPLVIQAFLKVD 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30394NP_611578.1 SdaC 8..392 CDD:223884 36/108 (33%)
SLC5-6-like_sbd 8..390 CDD:294310 36/108 (33%)
DUF4775 <394..652 CDD:292620
YukC <561..660 CDD:295067
slc38a3aNP_001092235.1 SLC5-6-like_sbd 70..>182 CDD:294310 35/103 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.