Sequence 1: | NP_726059.5 | Gene: | CG42672 / 37433 | FlyBaseID: | FBgn0261554 | Length: | 1642 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_065070.1 | Gene: | ANKRD50 / 57182 | HGNCID: | 29223 | Length: | 1429 | Species: | Homo sapiens |
Alignment Length: | 505 | Identity: | 151/505 - (29%) |
---|---|---|---|
Similarity: | 223/505 - (44%) | Gaps: | 96/505 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 196 IDDRDENATTVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTAL----LCA-SRNGHLDVVQLL 255
Fly 256 LDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVEL 320
Fly 321 LVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANV---DTAGMYSWTPL---------- 372
Fly 373 -----------------------LVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREGFQ 414
Fly 415 DIAASLIAAGAYINIQDR-GADTPLIHAVK--------------------------------AGH 446
Fly 447 RTVVEALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRNR 511
Fly 512 NLEIVHLLLDRKAKVTASDKRGDTCLHIAMRARSKTIVEALLRNPKHSQLLYRANKAGETPYN-- 574
Fly 575 ----IDSLHQKTILGQVFGARRLNTNEDSEGMLGYELYSSALADVLSEPT 620 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42672 | NP_726059.5 | ANK | 169..289 | CDD:238125 | 41/97 (42%) |
Ank_2 | 173..266 | CDD:289560 | 30/74 (41%) | ||
ANK repeat | 205..233 | CDD:293786 | 9/27 (33%) | ||
ANK | 231..355 | CDD:238125 | 58/128 (45%) | ||
ANK repeat | 235..266 | CDD:293786 | 18/35 (51%) | ||
Ank_2 | 240..332 | CDD:289560 | 42/96 (44%) | ||
ANK repeat | 268..299 | CDD:293786 | 15/30 (50%) | ||
ANK repeat | 301..332 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 306..398 | CDD:289560 | 41/127 (32%) | ||
ANK | 329..454 | CDD:238125 | 52/193 (27%) | ||
ANK repeat | 334..362 | CDD:293786 | 13/30 (43%) | ||
ANK repeat | 367..398 | CDD:293786 | 14/63 (22%) | ||
ANK repeat | 400..431 | CDD:293786 | 13/30 (43%) | ||
Ank_4 | 401..454 | CDD:290365 | 20/85 (24%) | ||
ANK | 428..553 | CDD:238125 | 36/157 (23%) | ||
ANK repeat | 435..464 | CDD:293786 | 11/60 (18%) | ||
Ank_2 | 438..530 | CDD:289560 | 25/123 (20%) | ||
ANK repeat | 466..497 | CDD:293786 | 7/30 (23%) | ||
ANK repeat | 499..530 | CDD:293786 | 8/30 (27%) | ||
Ank_5 | 518..575 | CDD:290568 | 16/62 (26%) | ||
KAP_NTPase | 605..1136 | CDD:284995 | 3/16 (19%) | ||
SAM_superfamily | 1357..1392 | CDD:188886 | |||
ANKRD50 | NP_065070.1 | AAA_16 | 22..195 | CDD:289934 | |
Cas9_REC | <221..>352 | CDD:293200 | |||
ANK 1 | 477..509 | ||||
ANK | <495..598 | CDD:238125 | |||
ANK 2 | 511..540 | ||||
Ank_5 | 531..585 | CDD:290568 | |||
ANK repeat | 544..575 | CDD:293786 | |||
ANK 3 | 544..573 | ||||
ANK | 573..697 | CDD:238125 | 6/26 (23%) | ||
ANK repeat | 577..608 | CDD:293786 | |||
ANK 4 | 577..606 | ||||
Ank_2 | 582..674 | CDD:289560 | 0/3 (0%) | ||
ANK repeat | 610..641 | CDD:293786 | |||
ANK 5 | 610..639 | ||||
ANK repeat | 643..674 | CDD:293786 | 0/3 (0%) | ||
ANK 6 | 643..672 | 0/1 (0%) | |||
Ank_2 | 648..745 | CDD:289560 | 30/74 (41%) | ||
ANK repeat | 676..707 | CDD:293786 | 9/30 (30%) | ||
ANK 7 | 676..705 | 9/28 (32%) | |||
ANK repeat | 709..745 | CDD:293786 | 18/35 (51%) | ||
ANK 8 | 709..743 | 17/33 (52%) | |||
ANK | 742..867 | CDD:238125 | 49/127 (39%) | ||
ANK repeat | 747..778 | CDD:293786 | 15/30 (50%) | ||
ANK 9 | 747..776 | 15/28 (54%) | |||
Ank_2 | 752..844 | CDD:289560 | 38/91 (42%) | ||
ANK repeat | 780..811 | CDD:293786 | 10/30 (33%) | ||
ANK 10 | 780..809 | 10/28 (36%) | |||
ANK | 808..932 | CDD:238125 | 40/126 (32%) | ||
ANK repeat | 813..844 | CDD:293786 | 13/30 (43%) | ||
ANK 11 | 813..842 | 13/28 (46%) | |||
ANK 12 | 846..875 | 6/31 (19%) | |||
ANK repeat | 847..877 | CDD:293786 | 5/32 (16%) | ||
Ank_2 | 851..943 | CDD:289560 | 24/91 (26%) | ||
ANK repeat | 879..910 | CDD:293786 | 10/30 (33%) | ||
ANK 13 | 879..908 | 10/28 (36%) | |||
ANK repeat | 912..943 | CDD:293786 | 13/30 (43%) | ||
ANK 14 | 912..941 | 12/28 (43%) | |||
ANK repeat | 945..976 | CDD:293786 | 4/30 (13%) | ||
ANK 15 | 945..974 | 4/28 (14%) | |||
Ank_4 | 946..999 | CDD:290365 | 7/52 (13%) | ||
ANK | 974..1097 | CDD:238125 | 33/135 (24%) | ||
ANK repeat | 978..1009 | CDD:293786 | 8/30 (27%) | ||
ANK 16 | 978..1007 | 8/28 (29%) | |||
Ank_2 | 983..1075 | CDD:289560 | 23/91 (25%) | ||
ANK repeat | 1011..1042 | CDD:293786 | 7/30 (23%) | ||
ANK 17 | 1011..1040 | 7/28 (25%) | |||
ANK repeat | 1044..1075 | CDD:293786 | 8/30 (27%) | ||
ANK 18 | 1044..1073 | 8/28 (29%) | |||
Ank_2 | 1049..>1110 | CDD:289560 | 19/73 (26%) | ||
ANK 19 | 1077..1107 | 11/42 (26%) | |||
ANK repeat | 1077..1102 | CDD:293786 | 10/37 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1108..1200 | 9/51 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1217..1296 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |