Sequence 1: | NP_726059.5 | Gene: | CG42672 / 37433 | FlyBaseID: | FBgn0261554 | Length: | 1642 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013154.1 | Gene: | Rfxank / 306353 | RGDID: | 1311390 | Length: | 284 | Species: | Rattus norvegicus |
Alignment Length: | 210 | Identity: | 64/210 - (30%) |
---|---|---|---|
Similarity: | 95/210 - (45%) | Gaps: | 46/210 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 180 NDISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCAS 244
Fly 245 RNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWA 309
Fly 310 AGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLV 374
Fly 375 AAAGGHTDCVSSILE 389 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42672 | NP_726059.5 | ANK | 169..289 | CDD:238125 | 26/108 (24%) |
Ank_2 | 173..266 | CDD:289560 | 16/85 (19%) | ||
ANK repeat | 205..233 | CDD:293786 | 4/27 (15%) | ||
ANK | 231..355 | CDD:238125 | 39/123 (32%) | ||
ANK repeat | 235..266 | CDD:293786 | 3/30 (10%) | ||
Ank_2 | 240..332 | CDD:289560 | 29/91 (32%) | ||
ANK repeat | 268..299 | CDD:293786 | 15/30 (50%) | ||
ANK repeat | 301..332 | CDD:293786 | 12/30 (40%) | ||
Ank_2 | 306..398 | CDD:289560 | 31/84 (37%) | ||
ANK | 329..454 | CDD:238125 | 21/61 (34%) | ||
ANK repeat | 334..362 | CDD:293786 | 11/27 (41%) | ||
ANK repeat | 367..398 | CDD:293786 | 7/23 (30%) | ||
ANK repeat | 400..431 | CDD:293786 | |||
Ank_4 | 401..454 | CDD:290365 | |||
ANK | 428..553 | CDD:238125 | |||
ANK repeat | 435..464 | CDD:293786 | |||
Ank_2 | 438..530 | CDD:289560 | |||
ANK repeat | 466..497 | CDD:293786 | |||
ANK repeat | 499..530 | CDD:293786 | |||
Ank_5 | 518..575 | CDD:290568 | |||
KAP_NTPase | 605..1136 | CDD:284995 | |||
SAM_superfamily | 1357..1392 | CDD:188886 | |||
Rfxank | NP_001013154.1 | ANKYR | 89..271 | CDD:223738 | 64/210 (30%) |
ANK repeat | 118..145 | CDD:293786 | 8/69 (12%) | ||
ANK repeat | 147..178 | CDD:293786 | 15/30 (50%) | ||
Ank_2 | 152..242 | CDD:403870 | 37/89 (42%) | ||
ANK repeat | 180..211 | CDD:293786 | 12/30 (40%) | ||
ANK repeat | 213..241 | CDD:293786 | 11/27 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |