DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL29 and rpl29

DIOPT Version :10

Sequence 1:NP_477203.1 Gene:RpL29 / 37430 FlyBaseID:FBgn0016726 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001003434.1 Gene:rpl29 / 445040 ZFINID:ZDB-GENE-040801-167 Length:64 Species:Danio rerio


Alignment Length:64 Identity:35/64 - (54%)
Similarity:47/64 - (73%) Gaps:6/64 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGN------LSREESVK 58
            ||||||||.|||::|.||||||:|..:|:||..|:|.|||.|.|:|:|.|      ::|:|:.|
Zfish     1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGAKTIARKEASK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL29NP_477203.1 Ribosomal_L29e 4..42 CDD:460324 24/37 (65%)
rpl29NP_001003434.1 Ribosomal_L29e 4..42 CDD:460324 24/37 (65%)

Return to query results.
Submit another query.