DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL29 and rpl29

DIOPT Version :10

Sequence 1:NP_477203.1 Gene:RpL29 / 37430 FlyBaseID:FBgn0016726 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_596316.1 Gene:rpl29 / 2541172 PomBaseID:SPBC776.01 Length:61 Species:Schizosaccharomyces pombe


Alignment Length:58 Identity:34/58 - (58%)
Similarity:41/58 - (70%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK 58
            ||||||||||||||||||||||||.:.|::|....|.||..||::|.:|.:......|
pombe     1 MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSLKYRDAKFRRNQKFANRGTVEAIRQAK 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL29NP_477203.1 Ribosomal_L29e 4..42 CDD:460324 26/37 (70%)
rpl29NP_596316.1 Ribosomal_L29e 4..42 CDD:460324 26/37 (70%)

Return to query results.
Submit another query.