DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL29 and Rpl29

DIOPT Version :10

Sequence 1:NP_477203.1 Gene:RpL29 / 37430 FlyBaseID:FBgn0016726 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_033108.1 Gene:Rpl29 / 19944 MGIID:99687 Length:160 Species:Mus musculus


Alignment Length:81 Identity:36/81 - (44%)
Similarity:51/81 - (62%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVKRYNERIA 65
            ||||||||.|||::|.||||||:|..:|:||..|:|.|||.|.|:|:|.|....:.::..|.:..
Mouse     1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAV 65

  Fly    66 SQKG-------KPKPV 74
            |.:.       ||:.:
Mouse    66 SARAEAIKALVKPQAI 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL29NP_477203.1 Ribosomal_L29e 4..42 CDD:460324 24/37 (65%)
Rpl29NP_033108.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 22/32 (69%)
Ribosomal_L29e 4..42 CDD:460324 24/37 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..160
2 X 8 AA tandem repeats of A-X-A-K-A-P-A-[KQ] 127..142
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.