DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL29 and rpl29

DIOPT Version :10

Sequence 1:NP_477203.1 Gene:RpL29 / 37430 FlyBaseID:FBgn0016726 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001165147.1 Gene:rpl29 / 100135409 XenbaseID:XB-GENE-5789751 Length:75 Species:Xenopus tropicalis


Alignment Length:71 Identity:35/71 - (49%)
Similarity:47/71 - (66%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVKRYNERIA 65
            ||||||||.|||::|.||||||:|..:|:||..|:|.|||.|.|:|:|.|....:.:...|.:.|
 Frog     1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGIKKMLANNAKNA 65

  Fly    66 SQKGKP 71
            :....|
 Frog    66 ASAPAP 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL29NP_477203.1 Ribosomal_L29e 4..42 CDD:460324 24/37 (65%)
rpl29NP_001165147.1 Ribosomal_L29e 4..42 CDD:460324 24/37 (65%)

Return to query results.
Submit another query.