DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf29 and SGF29b

DIOPT Version :9

Sequence 1:NP_001286673.1 Gene:Sgf29 / 37429 FlyBaseID:FBgn0050390 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001330202.1 Gene:SGF29b / 834053 AraportID:AT5G40550 Length:301 Species:Arabidopsis thaliana


Alignment Length:256 Identity:65/256 - (25%)
Similarity:102/256 - (39%) Gaps:65/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IQQNIHNVDEERRRAENSIASLVRSLHATNQKVKPLLKASLTEAAQEEATIRAALAKIHEIRSIR 83
            |.:|...:|..|:..|..:..:        .|:...|:|| .|..::...|  :|||:..:    
plant     9 ILENTKELDRLRKDQEEVLVEI--------NKMHKKLQAS-PEIVEKPGDI--SLAKLKNL---- 58

  Fly    84 NERRIQARNAGNKEAIRRGALMKMVQLSAQTLPLFVGKLGERAPALCGAIPAEGN---------- 138
               .|||:.....|......|:..:.|   .||  .|..|::...|  .:.||||          
plant    59 ---YIQAKELSENEVTVSNILLTQLDL---LLP--YGPTGQQRRKL--GVVAEGNDQKRKRMKVD 113

  Fly   139 ----------------YVAKVGDNVAA--LAKGIDEEENWILAEVVQFLHRQNKYDVIDIDEEQK 185
                            |.:..|:.|||  .|:..|::| |.:.:|:.| .|:.| :|..:|||..
plant   114 SDVIRLSPSMRNQIEAYASLKGEQVAARVTAESADKDE-WFVVKVIHF-DRETK-EVEVLDEEPG 175

  Fly   186 DRHVLSKRKVIPLPLM-------RANPETDGHALFPKDTVVMALYPQTTCFYKAIVHRLPQ 239
            |....|.::...||::       |.:|.....  ||....|:|:||.||..|||.|...|:
plant   176 DDEEGSGQRTYKLPMLCILPFPKRNDPSNTQE--FPPGKHVLAVYPGTTALYKATVVSTPR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf29NP_001286673.1 DUF1325 143..273 CDD:284459 35/106 (33%)
SGF29bNP_001330202.1 DUF1325 134..>237 CDD:399787 35/106 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4590
eggNOG 1 0.900 - - E1_KOG3038
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040796at2759
OrthoFinder 1 1.000 - - FOG0003702
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104305
Panther 1 1.100 - - O PTHR21539
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.