DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf29 and SGF29a

DIOPT Version :9

Sequence 1:NP_001286673.1 Gene:Sgf29 / 37429 FlyBaseID:FBgn0050390 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001326214.1 Gene:SGF29a / 822367 AraportID:AT3G27460 Length:272 Species:Arabidopsis thaliana


Alignment Length:263 Identity:66/263 - (25%)
Similarity:114/263 - (43%) Gaps:56/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IQQNIHNVDEERRRAEN---SIASLVRSLHATNQKVKPLLKASLT----------EAAQEEATIR 70
            |..|...:|..|:..|.   .|..:.:.|.||.:.|:.....||:          |.::.|.|:.
plant    10 ILDNTKELDRLRKEQEEVLVEINKMHKKLQATPEIVEKPGDISLSKLKNLYIQAKELSESEVTVS 74

  Fly    71 AALAKIHEIRSI-------RNERRIQARNAGNKEAIRRGALMKMVQLSAQTLPLFVGKLGERAPA 128
            ..|  :.::.|:       :..|::.|.  ||::..:|   || |......:          :|:
plant    75 NIL--LTQLDSLLPSGPTGQQRRKLVAE--GNEQKRKR---MK-VDTDVTRV----------SPS 121

  Fly   129 LCGAIPAEGNYVAKVGDNVAALAKGID-EEENWILAEVVQFLHRQNKYDVIDIDEEQKD------ 186
            :...|.|   |.:..|:.|||.....| |::.|.:.:|:.| .|:.| :|..:|||..|      
plant   122 MRNQIEA---YASLKGEQVAARVTAEDAEKDEWFVVKVIHF-DRETK-EVEVLDEEPGDDEEGGG 181

  Fly   187 --RHVLSKRKVIPLPLMRANPETDGHALFPKDTVVMALYPQTTCFYKAIVHRLP-QTATEDYEVL 248
              .:.||...::|.| .|.:|.:....:..|.  |:|:||.||..|||.|...| :..:::|.:.
plant   182 QRTYKLSMSCILPFP-KRNDPSSTQEFIPGKH--VLAVYPGTTALYKATVISTPRKRKSDEYLLE 243

  Fly   249 FED 251
            |:|
plant   244 FDD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf29NP_001286673.1 DUF1325 143..273 CDD:284459 37/119 (31%)
SGF29aNP_001326214.1 DUF1325 133..267 CDD:399787 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4590
eggNOG 1 0.900 - - E1_KOG3038
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040796at2759
OrthoFinder 1 1.000 - - FOG0003702
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104305
Panther 1 1.100 - - LDO PTHR21539
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.