DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf29 and sgf29

DIOPT Version :9

Sequence 1:NP_001286673.1 Gene:Sgf29 / 37429 FlyBaseID:FBgn0050390 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_596000.2 Gene:sgf29 / 2540787 PomBaseID:SPBC1921.07c Length:244 Species:Schizosaccharomyces pombe


Alignment Length:253 Identity:50/253 - (19%)
Similarity:90/253 - (35%) Gaps:94/253 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TAESAAQQIQDRLKDIQQNIHNVDEERRRAENSIASL---VRSLHATNQKVKPLLKAS-LTEAAQ 64
            |.:.....|::|:|.....|...:|:::..|:::.||   :..|...|:  ||::..| ||    
pombe    38 TVDGDDNPIEERIKACDAGIQTSEEQKKELEHTMQSLEMIINVLEKANE--KPVITNSPLT---- 96

  Fly    65 EEATIRAALAKIHEIRSIRNERRIQARNAGNKEAIRRGALMKMVQLSAQTLPLFVGKLGERAPAL 129
                           ||.||                ||     ...:|.|:....|.      ::
pombe    97 ---------------RSRRN----------------RG-----TSFTANTVTFTPGM------SV 119

  Fly   130 CGAIPAEGNYVAKVGDNVAALAKGIDEEENWILAEVVQFLHR--QNKYDVIDIDEEQKD------ 186
            ...:|...:                :|..:||...:::....  :.:::|.|.:.:...      
pombe   120 AFKLPYTRH----------------NEGGDWIQCIIIKVTGEGAKQRFEVQDPEPDDDGNAGQIY 168

  Fly   187 ----RHVLS-KRKVIPLPLMRANPETDGHALFPKDTVVMALYPQTTCFYKA-IVHRLP 238
                .|::. ..|..|||           .:.|| |.|:|.||:||.||:| ::..||
pombe   169 KTTANHLIQIPAKGTPLP-----------PISPK-TNVLARYPETTTFYRAEVIRTLP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf29NP_001286673.1 DUF1325 143..273 CDD:284459 24/110 (22%)
sgf29NP_596000.2 DUF1325 115..242 CDD:284459 26/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3038
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003702
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21539
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.