DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf29 and T22B7.4

DIOPT Version :9

Sequence 1:NP_001286673.1 Gene:Sgf29 / 37429 FlyBaseID:FBgn0050390 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_508949.1 Gene:T22B7.4 / 180831 WormBaseID:WBGene00020673 Length:537 Species:Caenorhabditis elegans


Alignment Length:286 Identity:75/286 - (26%)
Similarity:146/286 - (51%) Gaps:32/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ESAAQQIQ-----DRLKDI-----QQNI--HNVDEERRRAENSIASLVRSLHATNQKVKPLLKAS 58
            |:|...:|     :.||::     |||:  ..:::..:::.|:.|..:..  ....:.|.|.|..
 Worm    17 ENAPPDVQHKMLVEMLKNVTIHMDQQNVARKEINDFHKKSGNNQAPAMNK--REKNEAKTLYKKH 79

  Fly    59 LTEAAQEEATIRAALAKIHEIRSIRNERRIQARNAGNKEAIRRGAL--MKMVQLSAQTLPLFVGK 121
            |.:..:          .::::..:.|..::...||.| |:..:|.|  :::::|....||: :..
 Worm    80 LNQGQE----------GMNQLEELINNMKLWRANAIN-ESREKGDLNAIEIMKLKHGCLPI-INM 132

  Fly   122 LGERAPALCGAIPAEGNYVAKVGDNVAALAKGIDEEENWILAEVVQFLHRQNKYDVIDIDEEQKD 186
            .....|...||:|.:.|...:..|.|||.   ::|...||||||...: ..::|:.||:|:::|.
 Worm   133 EKNPEPYGAGALPLQKNTRLEKYDEVAAF---VEETNTWILAEVKGSI-SNHRYECIDVDDQEKK 193

  Fly   187 RHVLSKRKVIPLPLMRANPETDGHALFPKDTVVMALYPQTTCFYKAIVHRLPQTATEDYEVLFED 251
            ..|.:::::||:|....|.:...|...|::.:|:|:||.|||||..|||..|:..:..|::.|.|
 Worm   194 LLVFTRKQLIPMPRFTVNYDKYPHMALPENAIVLAVYPGTTCFYDGIVHEPPKIVSGFYKIRFTD 258

  Fly   252 SSYTNGYAEPLPVAQRYVIAYRPTKK 277
            :......::|:.|::|||:|::...|
 Worm   259 NQKPGKLSDPMEVSERYVVAFKSEPK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf29NP_001286673.1 DUF1325 143..273 CDD:284459 45/129 (35%)
T22B7.4NP_508949.1 DUF1325 154..280 CDD:369181 45/129 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167004
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3038
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040796at2759
OrthoFinder 1 1.000 - - FOG0003702
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104305
Panther 1 1.100 - - O PTHR21539
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.