DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf29 and SGF29

DIOPT Version :9

Sequence 1:NP_001286673.1 Gene:Sgf29 / 37429 FlyBaseID:FBgn0050390 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_612423.1 Gene:SGF29 / 112869 HGNCID:25156 Length:293 Species:Homo sapiens


Alignment Length:289 Identity:145/289 - (50%)
Similarity:193/289 - (66%) Gaps:19/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SAAQQIQDRLKDIQQNIHNVDEERRRAENSIASLVRSLH---ATNQKVKPLLKASL-----TEAA 63
            ||..:|.:.|.::.|.|....|||.|:|:::.: ::..|   .|..|:.|..:..|     |..|
Human     5 SADSRIAELLTELHQLIKQTQEERSRSEHNLVN-IQKTHERMQTENKISPYYRTKLRGLYTTAKA 68

  Fly    64 QEEA---TIRAALAKIHEIRSIRNERRIQARNAG-------NKEAIRRGALMKMVQLSAQTLPLF 118
            ..||   .:|.||.||.||:|:..||||.|:.||       .::.:|||.||.::|.||.||||:
Human    69 DAEAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLMTLLQQSAMTLPLW 133

  Fly   119 VGKLGERAPALCGAIPAEGNYVAKVGDNVAALAKGIDEEENWILAEVVQFLHRQNKYDVIDIDEE 183
            :||.|::.|.|||||||.|:|||:.||.|||..|.:|.:|.|||||||.:.|..|||:|.|||||
Human   134 IGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEE 198

  Fly   184 QKDRHVLSKRKVIPLPLMRANPETDGHALFPKDTVVMALYPQTTCFYKAIVHRLPQTATEDYEVL 248
            .|:||.||:|:|||||..:||||||..|||.|:.:|:||||||||||:|::|..||...:||.||
Human   199 GKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVL 263

  Fly   249 FEDSSYTNGYAEPLPVAQRYVIAYRPTKK 277
            |||:||.:||:.||.||||||:|.:..||
Human   264 FEDTSYADGYSPPLNVAQRYVVACKEPKK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf29NP_001286673.1 DUF1325 143..273 CDD:284459 81/129 (63%)
SGF29NP_612423.1 DUF1325 158..288 CDD:399787 81/129 (63%)
Histone H3K4me3 N-terminus binding. /evidence=ECO:0000269|PubMed:21685874, ECO:0000269|PubMed:26578293 194..196 1/1 (100%)
Histone H3K4me3 N-terminus binding. /evidence=ECO:0000269|PubMed:21685874, ECO:0000269|PubMed:26578293 240..243 2/2 (100%)
Histone H3K4me3 binding. /evidence=ECO:0000269|PubMed:21685874 264..266 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159384
Domainoid 1 1.000 175 1.000 Domainoid score I3665
eggNOG 1 0.900 - - E1_KOG3038
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12607
Inparanoid 1 1.050 270 1.000 Inparanoid score I3017
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49936
OrthoDB 1 1.010 - - D1040796at2759
OrthoFinder 1 1.000 - - FOG0003702
OrthoInspector 1 1.000 - - oto91641
orthoMCL 1 0.900 - - OOG6_104305
Panther 1 1.100 - - LDO PTHR21539
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4309
SonicParanoid 1 1.000 - - X5434
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.