DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10505 and YKR104W

DIOPT Version :9

Sequence 1:NP_611571.2 Gene:CG10505 / 37428 FlyBaseID:FBgn0034612 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_013030.1 Gene:YKR104W / 853979 SGDID:S000001812 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:123/302 - (40%)
Similarity:172/302 - (56%) Gaps:44/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1011 MTSVERVLEYAQTPSE------PPLESPKSVNLAAEWPQAGHLRFQDLRMRYSPGDEDILRGLNF 1069
            |:||||:.||...|||      ||          |.|||.|.:..::|.:||||.....|..::|
Yeast     1 MSSVERIKEYTDIPSESNGYISPP----------ANWPQTGDVELKNLSLRYSPHSSKALDNVSF 55

  Fly  1070 ESQPMEKIGIVGRTGAGKSSIIQALFRLA-LNEGTIEIDGLDIGKLGLHDLRSRISIIPQDPVLF 1133
            :.:...|:||||||||||||||.|::||: ...|||.||..||..:.|..||:.||.|||||.||
Yeast    56 KVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLF 120

  Fly  1134 SGTLRFNLDPFDEKSDESLWSALDDV-----------------------KLKKHVASLEGGLSCR 1175
            .||:|.||||||..||..::..|..|                       ||:.....    |:..
Yeast   121 DGTVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFID----LNTV 181

  Fly  1176 MQDGGSNFSMGQRQLVCLARAILRQNRVLVMDEATANVDTETDILIQETIQTKFAECTVLTIAHR 1240
            ::.||||.|.|||||:||||::|....::::|||||::|..:|..||:||:......|:||||||
Yeast   182 VKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTTILTIAHR 246

  Fly  1241 LHTVMDNDSVLVMDAGQIVEFGAPHKLLQRKDGALLKLVNQN 1282
            |.:|:|.|.:|||:.|::.|:..|:.|:..::....:|..|:
Yeast   247 LRSVIDYDKILVMEMGRVKEYDHPYTLISDRNTIFYRLCRQS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10505NP_611571.2 CFTR_protein 12..1268 CDD:273530 120/286 (42%)
ABC_membrane 95..360 CDD:294371
ABCC_MRP_domain1 428..632 CDD:213217
ABC_membrane 728..994 CDD:294371
ABCC_MRP_domain2 1045..1264 CDD:213211 103/242 (43%)
YKR104WNP_013030.1 ABCC_NFT1 27..270 CDD:213269 106/246 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344663
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.