DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10505 and NAP5

DIOPT Version :9

Sequence 1:NP_611571.2 Gene:CG10505 / 37428 FlyBaseID:FBgn0034612 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_177289.1 Gene:NAP5 / 843474 AraportID:AT1G71330 Length:324 Species:Arabidopsis thaliana


Alignment Length:328 Identity:98/328 - (29%)
Similarity:157/328 - (47%) Gaps:52/328 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 EEKRYRAVVHACQLDRDLELLPRGDATVVGERGISLSGGQKARIALARAVYRQADIYLFDDPLAA 586
            :.:||..|:.||.|.:|||:|..||.||:|||||:||||||.||.:|||:|:.|||||||||.:|
plant     2 DRERYDKVIEACSLSKDLEILSFGDQTVIGERGINLSGGQKQRIHIARALYQDADIYLFDDPFSA 66

  Fly   587 VDAQVGKLLMDKCFHRLLDGKMRILVTHHVQLLKSVDQLLLLEGGKLTQQGSYEELKDVITHHAA 651
            |||..|..|..:....||..|..|.|||.|:.|.|.|..|:::.|:::|.|.|   .|::.  :.
plant    67 VDAHTGSHLFKEALRGLLCSKSVIYVTHQVEFLPSADLTLVMKDGRISQAGKY---NDILI--SG 126

  Fly   652 LDLEAIEADKQQVKRVLSQVDRTSKQLSKGEEKDPATIQDENG---------------------- 694
            .|...:....|:...|:...|.:|...:...:::...::|:.|                      
plant   127 TDFRELIGAHQESLAVVGSADASSVSENSALDEENGVVRDDIGFDGKQESQDLKNDKLDSGEPQR 191

  Fly   695 ---NAEQQLQGAVSYDTYKAYFR-ALGAPFLVCLVLSMFVLARGCQAVMDIFISRWATWEEDRGY 755
               ..|::.:|:|:.|.|..|.. |.|...:..::|...:.     .::.|..:.|..|..... 
plant   192 QFVQEEERAKGSVALDVYWKYITLAYGGALVPFILLGQILF-----QLLQIGSNYWMAWATPIS- 250

  Fly   756 DSVDDYEA---TRTKMVIWYTVL----LLLTLALFLLRTFGFFFMCLRISLTLHDQLYHGIIRAW 813
               :|.:|   ..|.||::..:.    |.:.:...||.|.|:     :.:..|..:::|.|.|:.
plant   251 ---EDVQAPVKLSTLMVVYVALAFGSSLCILVRATLLVTAGY-----KTATELFHKMHHCIFRSP 307

  Fly   814 MYF 816
            |.|
plant   308 MSF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10505NP_611571.2 CFTR_protein 12..1268 CDD:273530 98/328 (30%)
ABC_membrane 95..360 CDD:294371
ABCC_MRP_domain1 428..632 CDD:213217 58/109 (53%)
ABC_membrane 728..994 CDD:294371 19/96 (20%)
ABCC_MRP_domain2 1045..1264 CDD:213211
NAP5NP_177289.1 P-loop_NTPase <1..112 CDD:304359 58/109 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.