DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS16 and YOL162W

DIOPT Version :9

Sequence 1:NP_726048.1 Gene:MFS16 / 37427 FlyBaseID:FBgn0034611 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_014480.1 Gene:YOL162W / 854002 SGDID:S000005522 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:36/196 - (18%)
Similarity:69/196 - (35%) Gaps:63/196 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 LRYFLSMGMILTGVFTYMFGIARTSN--IHSLWYFIIV--------QIFAGIFQTTGWPGVVALV 223
            |..:|::.:...|..|:...:....|  :|.|..|.:.        ::...:.|......::|::
Yeast    12 LATYLTLVLRSIGFTTFQANLLAIPNFVLHILLLFGLTWSTEKCNNRLGLSLLQPLYTVPLLAVL 76

  Fly   224 GRWFGKSKRGLIFGIWNSHTSIGNIL------------------------------------GTL 252
            ..|     :|.:|..|.::..|..||                                    |.:
Yeast    77 RFW-----KGTMFNKWGTYAIITLILDNPYIHAICVSLCSRNSQSVKTRTVSTCLYNMFVQAGLI 136

  Fly   253 IAAH-YVESDWALSFVVPGIIIAAVGFLLFLFLVDQPEIVG---CYPQAG-QHERRVANESDVEQ 312
            |::: |.:||..|.....|::.   |..||:|    |.::|   .|.... |.::|....|:.|:
Yeast   137 ISSNIYAKSDAPLYRKGNGVLF---GLALFMF----PILIGSKLIYVYINKQRDKRWNAMSEEEK 194

  Fly   313 D 313
            |
Yeast   195 D 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS16NP_726048.1 UhpC 84..545 CDD:225180 36/196 (18%)
MFS 139..549 CDD:119392 36/196 (18%)
YOL162WNP_014480.1 MFS <1..169 CDD:421695 29/168 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344244
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.