DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS16 and Spns3

DIOPT Version :9

Sequence 1:NP_726048.1 Gene:MFS16 / 37427 FlyBaseID:FBgn0034611 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_006246848.1 Gene:Spns3 / 497946 RGDID:1561884 Length:514 Species:Rattus norvegicus


Alignment Length:421 Identity:88/421 - (20%)
Similarity:158/421 - (37%) Gaps:96/421 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 FDVPDATTLFGMLDSAFLFSYAIAMFASGFVAERVSLRYFLSMGMILTGVFTYMFGIARTSNIHS 197
            |.:.|:..  |:|.:.|:....::....|::.:|.|.:..||.|::|..      |...:|:..|
  Rat    80 FHISDSHA--GLLQTVFIGCLLVSAPVFGYLGDRYSRKAILSFGVLLWS------GAGLSSSFIS 136

  Fly   198 LWYFIIVQIFAGIFQTTGWPGVVA-------LVGRWFGKSKRGLIFGIWNSHTSIGNILGTLIAA 255
            ..|..:..:..||..|    |..:       ::|..|.|.:|.....::.....:|:.||.::.:
  Rat   137 YQYSWLFFLSRGIVGT----GAASYSTIAPTVLGDLFVKDQRTCALAVFYIFIPVGSGLGYVLGS 197

  Fly   256 HYVESD----WALSFVVPGIIIAAVGFLLFLFLVDQPEIVGCYPQAGQHERRVANESDVEQDDEE 316
            ...|..    |||. ::|.:...|:. ||.|.:.|.|                  ....|:..|.
  Rat   198 TVAELTGNWRWALR-IMPCLDAVALA-LLILLVPDLP------------------RGAAEKQGEV 242

  Fly   317 QVRHNDAEINYRSAPTERTPILPRSQPEAVPRGRGRPISLIDALFIPGVVEFSLCLFFTKLVSYT 381
            .||                  .|||......|..||..|.:.:..  ||...:       .|:..
  Rat   243 PVR------------------APRSSWYEDVRYLGRNWSFVFSTL--GVTAIA-------FVTGA 280

  Fly   382 FMYWLPLYIQKSSTL-GPEL--------SADLSTLFD--------VGGILGAIAAGYLSDVSGMS 429
            ..:|.|.::.::..: |.:|        |.| |.:|.        :|.:|||.|:.....|:..:
  Rat   281 LGFWAPKFLFEARVVHGLQLPCFQEQCHSQD-SLIFGALTVATGIIGVMLGAEASRKYKKVNPRA 344

  Fly   430 -ATVCTGMLFVASPILLMYQQYGALSMTISIVLLIVVGIFVNGPYALITTSVSAELGQHSSLEGN 493
             ..:|...||..:|.|.:.....:.::..|.|.|.:..:.::..:|::...:.:.:...  ..|.
  Rat   345 EPLICASSLFATAPCLYLALILASRTLLASYVFLALGELLLSCNWAVVADILLSVVVPR--CRGT 407

  Fly   494 ANALATVTAIIDGTGSIGAAVGPLLAGLIST 524
            |.||....|.:     :|.|..|.|.||||:
  Rat   408 AEALQITVAHV-----LGDAGSPYLTGLISS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS16NP_726048.1 UhpC 84..545 CDD:225180 88/421 (21%)
MFS 139..549 CDD:119392 86/415 (21%)
Spns3XP_006246848.1 MFS 53..470 CDD:119392 88/421 (21%)
MFS_1 55..418 CDD:284993 80/399 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.