DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30391 and CG13843

DIOPT Version :9

Sequence 1:NP_611566.2 Gene:CG30391 / 37423 FlyBaseID:FBgn0050391 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_651069.1 Gene:CG13843 / 42668 FlyBaseID:FBgn0038993 Length:362 Species:Drosophila melanogaster


Alignment Length:269 Identity:59/269 - (21%)
Similarity:107/269 - (39%) Gaps:50/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VEKRVIKILLVIEEKYRSYFDSYR--KELELQRIAAETLHQLIQRYKITMQLDTSC--TCPQIYD 100
            :|:.|.:..||:::|.::..:...  |..:::|:.....|.:  ||:| :...|.|  |.|:...
  Fly   107 LEQCVHEQTLVVDQKMKALKNELEQAKPFQIERVKEMRYHGV--RYRI-LASSTGCTKTYPEYIS 168

  Fly   101 IESDDAIINKFYIHYQVIASSNKNQCWAIQSLRPYVLVFRRECAKLNRSEESPFILGDAFHKPIQ 165
            ..:::..:.:|...|.::..||.:.......:........:..|:|:||      ||..|.|.:.
  Fly   169 RMTEERALCEFQRAYNIVNQSNTDLSNLYLDMSESKKELDQRVARLDRS------LGSTFLKELD 227

  Fly   166 FFIDLVEELFAYFYSGHLQLDCAARLLDPLDLYRMECYMKLLEPNEDFAEYFLHNISFCKCMRPP 230
            ..:.::|:|..||:...::|...|.|:||:..:.:|.|:.||....||..:....:..|.|.|..
  Fly   228 SVLQIIEDLNTYFFGVIVKLKTWAELMDPMKEHSIEDYLGLLSQETDFRTFMSAGMENCTCKRCD 292

  Fly   231 PMCP--PY-------------------------------EHHQKIKDQSDAYLSHAKKKRCARRF 262
            ...|  ||                               :|...|...||..|    ..|.|...
  Fly   293 KKDPLKPYLPCWCQMESSEDVTNLKNFDDDCPKNIAGITQHESDIVTPSDTSL----LVRAADEK 353

  Fly   263 ERMAQNEAQ 271
            .|:|.|:|:
  Fly   354 ARLAMNQAE 362



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.